KEGG   Nocardia brasiliensis: O3I_025495Help
Entry
O3I_025495        CDS       T02270                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
nbr  Nocardia brasiliensis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    O3I_025495
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    O3I_025495
Enzymes [BR:nbr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     O3I_025495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5835022..5836422
Genome map
AA seq 466 aa AA seqDB search
MPGFDTLLPRPVSATPLSGTCPWPAAVDIRSGTDLPAEGYRLEITPDAITLTAADHAGRV
YGQQTLRQLAGPEALRAAPIGGRELSVPCGVIEDHPRFAWRGCLLDVARNFRTKAEVLRF
LDLLAAHKLNVLNLHLTDDQGWRFAVPGYPRLTEIASWRSGSMVGRHDGPERDGRPHGGF
YTDDDLREIVAYAAERAITVVPEIDVPGHARAVLAAYPELGPDPEKQWEVWTSWGVSTPL
LDPTPDTMAFFRRVFDHVLTLFPAPVIGLGGDEVPGATPAHGRFVAGLAAYLTAQGRRAL
GWDEVLDAGDLPPMVIGAWRDEAAAERAAKAGHEVVLCPEDQVYLDHRQSDHPDEPIPVG
YLRTLEDMYSYEPAYTGPGVIGLQAQIWSEHLDTVRRVDYAAFPRLCAIAETAWSPADRD
LGEFRTRLREHHLPRLDALGVEYRPLDGPHPWQTRPDVPSSAHRPR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcccggtttcgacaccctgctcccccgcccggtctcggcgaccccgctgtccggcacc
tgtccatggcccgccgcggtcgatatccgcagcggcacagaccttccggccgagggctac
cggctggagatcaccccggacgccatcacgctcacggccgcggatcacgcgggccgggtc
tacggacagcagacgctgcgccagctcgccggcccggaggcgttgcgggccgccccgatc
ggcggtcgggagctgtcggtgccgtgcggtgtcatcgaggaccatccgcgcttcgcttgg
cgcggctgcctgctcgacgtcgcccggaacttccggacgaaggccgaggtgctgcggttc
ctcgacctgctcgcggcgcacaagctcaacgtgctgaacctgcatctgaccgatgaccag
ggctggcggttcgcggtgcccggttacccgcgattgaccgagatcgcctcgtggcgaagc
ggatcgatggtcggcaggcatgacggcccggaacgggacgggcgcccgcacggcggtttc
tacaccgacgacgacctccgcgagatcgtggcctacgccgcggaacgcgcgatcaccgtg
gtgcccgaaatcgacgtacccggtcatgcgcgggccgtgctcgccgcctatcccgaactc
ggccccgatcccgaaaagcagtgggaggtatggacttcgtggggtgtcagcaccccgctg
ctcgatccgacaccggacaccatggcgttcttccgccgcgtcttcgaccacgtgctcacc
ctcttcccggcaccggtcatcggcctcggtggtgacgaggtgcccggcgcgaccccggca
cacggtcgtttcgtcgccggcctggccgcctatctgacggcccaggggcgacgggcgctc
ggctgggacgaggtcctcgacgccggtgacctgccgccgatggtgatcggggcctggcgc
gacgaggccgcggccgagcgggcggccaaggcgggccacgaggtcgtgctgtgcccggaa
gatcaggtctatctcgatcatcggcagtccgatcacccggacgaaccgatcccggtcggc
tacctgcgcacgctcgaagacatgtacagctacgagcccgcctacaccgggccaggggtc
atcgggctgcaagcccagatctggagcgagcacctggacaccgtgcggcgagtcgactat
gcggccttcccgcgactctgcgcgatcgccgaaaccgcttggagcccagccgatcgcgac
ctcggcgagttccgcacgcggctacgcgagcaccatcttccccgcctcgacgccctcggc
gtggagtatcgcccgctcgacggaccacacccgtggcagacccggcccgacgtccccagc
tccgcgcaccggccgcgctga

DBGET integrated database retrieval system