KEGG   Nocardia brasiliensis: O3I_027405Help
Entry
O3I_027405        CDS       T02270                                 

Definition
RecD protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
nbr  Nocardia brasiliensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:nbr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6250182..6252098)
Genome map
AA seq 638 aa AA seqDB search
MTSIQLAQRGTGLLRTFNEAGVLSAADVHVAVRLGRLGREETGEVLFAAALAVRAVRSGS
VCLELYRMREIGIDADETWDTGERIDPATLPWPDIAAVVAALRVSPLVTGGPAGPLRPLR
LVESQGRDDSGPLLYLDRYYQQEQTVRRVLTERSGDHPVVDPNIVRRELDRLFDAPADGT
PDRQRLAAALAATHWTTVVAGGPGTGKTHTIARIIGLLDAHRKANPKLPALRIALAAPTG
KAAARLQEAVREQAAALGLPDLTAATLHRLLGWQRGRTTRFKYHEFNRLPYDVIVVDETS
MVSLTMMSRLFAALRPDTRLVLVGDPDQLASVDAGAVLADLVAGPVAGTPNPVLDQVLGA
DSPESAAPEQHPAALSVLERTRLRGGIVRLTRGRRFGGRIADLAVAVRAGDADTALELLR
AGGDELSLSAPDEMAAVRADVVHAARAVTAAALDGDAAGALTALESHRLLCAHRQGPFGV
ERWDRMAAEWAAAGGAGPESHHAPWYPGQPLLVTANDHEARIYNGDTGVVVRMADGSLRA
ALQRGSEPYLVHPTQFPAVVTVFAMTIHRSQGSQYDTVSVVLPEPESTLLTRELLYTAIT
RARRHVRIIGTDESIRAGIARRVLRASGLSRTAGADGR
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
gtgacctcgatccagttggcgcagcgcggaaccgggctgttgcgcaccttcaacgaggcg
ggcgtgctctcggccgccgacgtgcacgtcgcggtgcggctcggccgtttggggcgggag
gagaccggcgaggtgctgttcgcggccgccctggccgtgcgcgcggtgcgttccggctcg
gtctgtctcgagctgtaccggatgcgcgagatcggcatcgacgccgacgagacctgggac
accggcgagcggatcgacccggcgaccctgccgtggcccgatatcgcggcggtcgtggcc
gcgctgcgggtgagtccgctggtgaccggcggtccggcgggcccgttgcggccgttgcgg
ctggtcgaatcgcagggccgcgacgattccggcccgctgctctacctcgatcggtattac
cagcaggagcagaccgtgcgccgggttctcaccgagcgctccggcgaccaccccgtggtg
gacccgaatatcgttcggcgcgaactggatcggctgttcgacgcgccggccgacgggacg
ccggaccggcagcggctggccgccgcgctcgccgcgacgcactggaccaccgtggtggcg
ggcggtccgggcaccggcaagacgcacaccatcgcgcgcatcatcggcctgctcgacgcg
caccgcaaagccaatcccaaactccccgcgctgcggatcgcgctggccgcgccgacgggc
aaggcggcggcccggttgcaggaggcggtgcgcgaacaggcggcggcgctcgggctgccc
gatctgacggccgccacgctgcaccggctgctcggctggcagcgcggccgcaccacccgg
ttcaagtatcacgaattcaaccgcctgccctacgacgtgatcgtcgtcgacgagacctcg
atggtgtcgctgaccatgatgagcaggctgttcgccgcgctgcgcccggataccaggctg
gtgctcgtcggcgaccccgaccagctcgcctcggtggacgcgggcgcggtgctcgccgac
ctcgtcgcgggaccggtcgcgggcacgccgaatccggtgctggatcaggtcctcggcgcg
gattcgccggaatcggccgcgccggaacagcatccggccgccctgagcgtgctggagcgc
acccggctgcgcggcggcatcgtccggctgacccggggccgccgcttcggcggccggatc
gcggacctcgcggtggcggtccgtgcgggcgacgccgacaccgcgctcgagctgctgcgt
gcgggtggggacgagctgtcgctcagcgcacccgacgaaatggccgccgtgcgtgccgat
gtcgtgcacgccgcgcgtgcggtcacggccgcggcgctcgacggggacgcggcgggcgcg
ttgaccgcgctggaatcgcaccggctgctctgcgcgcaccggcagggtccgttcggtgtc
gagcgctgggatcggatggcggccgaatgggcggccgccgggggagcagggcccgaatcc
caccatgcgccttggtatccggggcagccgctgctcgtcaccgcgaacgatcacgaggcg
cgcatctacaacggtgacaccggcgtcgtggtgcgcatggccgacgggtcgctgcgtgcc
gcgctgcaacgcggcagcgagccgtatctggtgcaccccacccagttcccggccgtggtc
accgtgttcgccatgaccatccaccgcagtcagggcagccagtacgacactgtctcggtg
gtgctgcccgaaccggagtcgaccctgctgaccagggagctgctctacaccgcgatcacc
cgcgcccgccgccacgtccgcatcatcggcaccgacgagtcgatccgggccggcatcgcg
cgccgcgtgctgcgcgccagcgggttgtcccggaccgccggggcggacgggcggtga

DBGET integrated database retrieval system