KEGG   Nocardia brasiliensis: O3I_028050Help
Entry
O3I_028050        CDS       T02270                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nbr  Nocardia brasiliensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    O3I_028050 (tpiA)
   01230 Biosynthesis of amino acids
    O3I_028050 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3I_028050 (tpiA)
   00051 Fructose and mannose metabolism
    O3I_028050 (tpiA)
   00562 Inositol phosphate metabolism
    O3I_028050 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    O3I_028050 (tpiA)
Enzymes [BR:nbr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     O3I_028050 (tpiA)
Exosome [BR:nbr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   O3I_028050 (tpiA)
  Exosomal proteins of bladder cancer cells
   O3I_028050 (tpiA)
  Exosomal proteins of melanoma cells
   O3I_028050 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6387034..6387819)
Genome map
AA seq 261 aa AA seqDB search
MARKPLIAGNWKMNLNHLEAIALVQKIAFALPEKYFAKVDVTVVPPFTDLRSVQTLVEGD
KLLLTYGAQDLSRHDAGAYTGEISGAMLAKLGCTYVVVGHSERRQYHGEDDATVLAKAKQ
ALKHGITPIVCIGEGLDVREAKTHVEYNLEQLRGSLKGLTAEEISKIVIAYEPVWAIGTG
KVATPADAQEVCGAIRGELVELASAEVAADLRVLYGGSVNAKNIGELIKQTDIDGALVGG
ASLKGDEFATLSAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaagccgctcatcgcgggcaactggaagatgaacctcaatcacctcgaggcc
atcgctctggtgcagaagatcgcgttcgccctgccggagaagtacttcgccaaggtcgac
gtcaccgtcgtgccgccgttcaccgatctgcgcagtgtgcagaccctggtggagggcgac
aagctcctgctcacctatggggcgcaggatctttcgcgccacgatgccggcgcctacacc
ggtgagatcagcggcgccatgctggcgaagctgggttgcacctatgtggtggtcgggcat
tcggagcggcggcagtaccacggcgaggacgacgccactgtgctcgccaaggccaagcag
gcgctcaagcacggaatcaccccgatcgtctgcatcggcgagggtctggatgtgcgcgag
gcgaagacacatgtcgagtacaacctcgagcagctgcggggttcgctgaaaggcctgacg
gcggaggagatctcgaagatcgtcatcgcctacgagccggtctgggcgatcggcaccggc
aaggtcgccaccccggccgacgcgcaggaagtgtgcggggccatccgcggcgagctggtc
gaactcgcctccgcggaggtggcggcggacctgcgggtgctctacggcggttcggtcaac
gccaagaacatcggcgagctgatcaagcagaccgatatcgacggcgcgctggtcggcggc
gcttcgctgaagggtgacgagttcgccaccctgtccgcgatcgccgcgggcggcccactg
ccgtaa

DBGET integrated database retrieval system