KEGG   Nocardia brasiliensis: O3I_028225Help
Entry
O3I_028225        CDS       T02270                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00230  Purine metabolism
nbr01100  Metabolic pathways
Module
nbr_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    O3I_028225 (gmk)
Enzymes [BR:nbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     O3I_028225 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_18 AAA_22 RsgA_GTPase AAA_33 MMR_HSR1 ABC_tran AAA_25 AAA_29 CPT Cytidylate_kin
Motif
Other DBs
NCBI-ProteinID: AFU03594
UniProt: K0F259
Position
complement(6424037..6424621)
Genome map
AA seq 194 aa AA seqDB search
MVEHTRKGRLVVLVGPSAVGKSTVVRCVRERLPHLIFSVSATTRAPRPGEVDGLDYRFVS
REEFDAMIEAGELLEWADIHGGLQRSGTPAAPVRAALADGLPVLVEVDLEGARSVRKAIP
EATLAFLAPPSWDELVSRLTSRGTESPEVIARRLETARTELAACDEFDIVIVNDEVTSAC
EQLVSLFVSTNSSS
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgaacacacgcggaagggtcggctggttgtactggtcggcccctcggccgttggc
aagtccaccgtggtccgctgcgtccgcgagcgactgccgcacctgatcttcagtgtgtcg
gcaacgacccgggctccgcggcccggggaggtcgacggtctcgactatcggttcgtgtcc
cgggaagagttcgacgccatgatcgaggcgggcgaactgctcgagtgggcggatattcac
ggtggcttgcagcgttcgggcaccccggcagcgccggtacgggccgctctagcggacggc
ctcccggtgttggtcgaagtggacctcgagggcgcgcggtcggtacgcaaagcgataccg
gaggcgaccctggcgtttctcgcgccgccgagctgggacgagctggtctcccggctcacc
tcgcgcgggaccgaatcgcccgaggtgatcgcccgcaggttggaaaccgccaggaccgaa
ctggcggcctgtgacgagttcgacatcgtcatagtgaacgacgaggtgaccagcgcctgt
gagcagttggtatcgttgttcgttagcacaaattcgagttcgtga

DBGET integrated database retrieval system