KEGG   Nocardia brasiliensis: O3I_028260Help
Entry
O3I_028260        CDS       T02270                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase catalytic subunit
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00240  Pyrimidine metabolism
nbr00250  Alanine, aspartate and glutamate metabolism
nbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    O3I_028260 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    O3I_028260 (pyrB)
Enzymes [BR:nbr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     O3I_028260 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace DUF4431
Motif
Other DBs
NCBI-ProteinID: AFU03601
UniProt: K0F7Z8
Position
complement(6432750..6433709)
Genome map
AA seq 319 aa AA seqDB search
MRHLLTVTDLDRAGATALLDEAERFEQALLGREVHKLPTLRGRTVMTVFYENSTRTRVSF
EVAGKWMSADVINVSASSSSVSKGESLRDTALTLHAAGADALIVRHPASGAAHQIARWMD
AWAVQSGRTSGPAIINAGDGTHQHPTQALLDALTLRQRLGDIEGKRVVIVGDILHSRVAR
SNVFLLNTLGAEVVLVAPRTLLPVGADSWPARVAHSLDAELPGADAVLMLRVQAERMNGG
FFPSAREYSINYGLSERRMALLDEHAVVLHPGPMLRGMEIASPVADSPKSAILQQVTNGV
HMRMAVLFRLLVGTQEAIA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtgagacatcttttgacggtcactgatctggatcgcgccggcgcgacggccctgctcgac
gaggccgaacgtttcgagcaggcgctgctcggccgtgaggtgcacaagctgccgaccttg
cgcggtcgcacggtgatgacggtgttctacgagaactccacgcgcacccgggtgtcgttc
gaggtggcgggcaagtggatgagcgccgacgtgatcaatgtgagcgccagtagttcgtcg
gtgtccaagggtgagtcgctgcgggacaccgcgctcaccttgcacgcggcgggcgcggac
gcgttgatcgtccggcatccggcttccggtgcggcacaccagatcgcgcgctggatggat
gcctgggcggtgcagtccggccgcacgtcgggcccggcgatcatcaacgcgggtgacggc
acgcatcagcatccgacgcaggcgctgctggacgcgctcacgctgcgccagcggctcggc
gatatcgagggcaagcgggtcgtgatcgtcggcgacatcctgcacagccgggtggcacgc
tcgaatgtcttcctgctcaatacccttggtgcggaggtggtgctggtcgcgccgcgcacg
ctgctcccggtgggcgcggacagctggcccgcgcgggtcgcgcactcgctcgacgccgaa
ttgccgggcgcggacgcggtgctcatgctgcgggtgcaggcggagcggatgaacggcggg
ttcttcccgtcggcccgcgagtactcgatcaactacggcttgtccgagcgccggatggcg
ctgctggacgagcacgcggtggtgctgcatccgggcccgatgttgcgcggcatggaaatc
gcgtcgccggtggcggattcgccgaagtccgcgatcctgcagcaggtgaccaacggagtg
cacatgcggatggccgtcctgttccggctgctggtcggtacccaggaggcgatcgcgtga

DBGET integrated database retrieval system