KEGG   Nocardia brasiliensis: O3I_029100Help
Entry
O3I_029100        CDS       T02270                                 

Definition
(GenBank) stearoyl-CoA 9-desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr01040  Biosynthesis of unsaturated fatty acids
nbr01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    O3I_029100
Enzymes [BR:nbr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     O3I_029100
Lipid biosynthesis proteins [BR:nbr01004]
 Desaturase
  First
   O3I_029100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase Phage_holin_3_6 PsbX Calici_PP_N
Motif
Other DBs
NCBI-ProteinID: AFU03769
UniProt: K0F2W4
Position
complement(6624003..6625004)
Genome map
AA seq 333 aa AA seqDB search
MNGREHYIYILAASILPFVGVIAAMVLLWNSLVGPADLAVFVIMSVIGGLGVSIGYHRLL
AHRSFKTTRPIKLFFVTAGAMAGQGPPLIWVAHHRRHHRVADKPGDPHSPYFEDRVDFRG
VVKGLWHSHLGWLFDKNLSSDPVRYCPDLCRDADIRFLSIRFVPVVLAGLLLPGLLGLAF
TGTLAGFLTGILWGGLVRMFIGNHVTYAVNSIGHYFGRRRFDTADESRNVFWLSIPSFGE
SWHNNHHAFPRSARHGFRWWELDLSALTIYTLEKLHLAWDIIRIDPARQRQRAAGLSRVG
SGRTAPHEPARPLAERGQASAKDLGPVDVADVE
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaacggccgcgagcactacatatatatcctcgcggcgtccatcctgcctttcgtcggc
gtcatcgcggccatggtgctgctgtggaactccctggtcggccccgcggacctcgccgtt
ttcgtcatcatgagcgtgatcggcggactgggggtttccatcggctatcaccgactgctc
gcgcaccggtcgttcaagaccacccggccgatcaaactcttcttcgtgaccgcgggggca
atggcaggtcaggggccgccgctcatctgggtcgcgcaccatcgccgccaccaccgggtg
gcggacaagcccggtgacccgcactcgccctacttcgaagaccgagtggacttccgcggc
gtcgtgaaaggtctgtggcactcgcacctgggctggctcttcgacaagaatctgtcctcc
gatccggtgcgctactgcccggatctctgccgggacgccgacatccgattcctgtcgatc
agattcgtgccggtcgtgctcgcgggcctgctgctgccgggtctgctcgggctggctttc
accggcaccttggccggttttctgaccggcatcctgtggggcgggctggtgcggatgttc
atcggtaaccacgtgacctacgcggtgaattcgatcggacactacttcggccgacgccgc
ttcgacaccgccgacgaatcccgcaacgtgttctggctgtcgatcccgtccttcggggaa
tcctggcacaacaaccaccacgcgttcccacggtcggcgcggcacggattccgttggtgg
gagctggatctcagtgccctcaccatctacacgctggagaagctgcatctggcctgggac
atcatccgcatcgacccggccagacagcggcaacgggccgccgggctgagccgggtcggc
agcggccgcaccgcaccgcacgagcccgcccgcccgctggccgagcgcgggcaggcgagc
gccaaggacctgggtcccgtcgacgttgcggatgtggaatga

DBGET integrated database retrieval system