KEGG   Nocardia brasiliensis: O3I_029375Help
Entry
O3I_029375        CDS       T02270                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
nbr  Nocardia brasiliensis
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:nbr00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:nbr00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:nbr00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6687068..6688933
Genome map
AA seq 621 aa AA seqDB search
MAQVEEAIDRTIEPGVVSRIVSDVFQLCRSDESGALADYIPELAAVQPDSFALCLATADG
RIYGTGEMETSFTIQSISKPFTYALALADRGTGAVDERIDVEPSGEAFNEISLDPVTERP
RNPMINAGAITAASLITGHDAAERFERIRACYSRFAGRELRMNEAVYASEARTGFRNRAI
GYMLRSFGIIDSDPDEAVDRYFRQCSIDVTCRDLALMAATLANNGRNPVTGERALTTALT
ERVLSVMTTCGMYNAAGDWVSTVGLPAKSGVGGGIVAVLPGQIGIAVYSPRLDPHGNSVR
GVAACRELSQRLELHFLHVTRAARTAIRAGYSVAEVPSRLRRTTEEIAVLAEHGHRARVY
ELHGDLLFAGAESAVRSIEEQAGDLEALVVDLRRVGEVSTIAVRMLDDLQTELAAVGVRV
ALVDPDAKLGHMVSSLDPDDPRGRVFIDRDTATEWCEDIVLERHRPADEPVCTSIAIEEH
PALMSLEQDDRTRLAKEFEVRTFARGEVIAARGSARSGLYLILEGRVRITFLGSDSRTHR
LVSLSAGMSFGEIPMLVGAAFANEARAEAGVRVAVLSPARFDQLTSQAPQLKLALLERLA
AGAYAQMDAAVRAIAVRGGDY
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
gtggcccaggtcgaagaggcgatcgacaggacaatcgaaccgggcgtcgtgtccaggatc
gtcagcgacgtcttccagctgtgccgctccgacgaatccggcgcgctggccgactacatt
cccgaactggctgcggtgcagccggattcattcgcgctgtgcctggccaccgcggacggg
cggatatacggcaccggagagatggagacttcgttcaccatccagtcgatctccaaaccg
ttcacctacgcactcgcgctggccgatcgcggcaccggcgcggtggacgagcgcatcgac
gtggagccctccggcgaggcgttcaacgagatcagtctggatccggtgaccgagcggccg
cgcaatccgatgatcaacgcgggcgccatcaccgccgcgtcactgatcaccggtcacgac
gccgctgagcgtttcgagcgcatccgcgcctgctattcgcgtttcgcgggccgtgaactg
cgcatgaacgaggcggtgtacgcgtccgaggcgcgcaccggattccgcaatcgcgcgatc
ggctacatgctgcgctcgttcggcatcatcgattccgacccggacgaggcggtagaccgc
tacttccggcagtgctcgatcgacgtgacctgccgcgatctcgcgctgatggcggcgacg
ctggcgaacaacgggcgcaatcccgtgaccggggagcgagcactgaccacggcgttgacc
gagcgggtgctcagcgtgatgaccacgtgcggcatgtacaacgcggcaggcgactgggtg
agcaccgtcggactgcccgcgaagagcggggtcggcggcggcatcgtcgcggtgctgccc
ggtcagatcggcatcgcggtgtactcgccgcgcctggacccgcacggcaacagtgtgcgc
ggcgtcgcggcgtgtcgtgagctgtcgcagcggttggaactgcacttcctgcacgtcacg
cgggcggcgcggaccgcgatccgggccggctactcggtcgccgaagtgccgtcgcgcctg
cgccggaccaccgaggagatcgcggtgctcgccgagcacgggcatcgcgcccgcgtctac
gaattgcacggcgacctgctgttcgcgggcgcggagagtgcggtgcgcagcatcgaggag
caggccggcgacctcgaggcgctcgtagtcgacctgcgccgggtcggtgaggtgagcacg
atcgcggtgcggatgctcgacgatctgcagaccgaactggccgccgtcggcgtgcgcgtc
gcgctggtggatcccgacgccaaactcgggcacatggtgtcgagcctggacccggacgac
ccgcgcggccgggtgttcatcgaccgggacacggccaccgaatggtgcgaggacatcgtg
ctcgagcgacatcggcccgccgacgaaccggtgtgcacatcgatcgcgatcgaggagcat
ccggcgctcatgtcgctcgagcaggatgatcggacgcgcctggccaaagagttcgaagtg
cgcacgttcgcgcgtggcgaggtgatcgccgcccgcgggagcgcccgctccggcctgtat
ctgatcctggagggccgggtccggatcacgttcctgggcagcgactcccgcacccatcgg
ctcgtcagcctgtccgcgggcatgtccttcggcgagattccgatgctggtcggcgcggcg
ttcgcgaacgaggccagggccgaggcgggcgtgcgggtggcggtgctcagtcctgcgcgc
ttcgatcagctcacctcgcaggcgccgcaattgaagctcgcgctgctcgagcgactcgcc
gcgggcgcgtacgcgcagatggacgcggcggtgcgggcgatcgcggtgcgcggcggcgac
tattga

DBGET integrated database retrieval system