KEGG   Nocardia brasiliensis: O3I_030690Help
Entry
O3I_030690        CDS       T02270                                 

Definition
putative magnesium chelatase subunit
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
nbr  Nocardia brasiliensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:nbr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6968327..6970381)
Genome map
AA seq 684 aa AA seqDB search
MSLSHAERLSSPGSLTGSSTDGEAGFPFSAVVGQERLQLALILCAVHPGIGGVLVRGEKG
TAKSTVVRALAQLLPPVVDETGARPARLVELPVGATEDRVVGSLDLERVLRDGEQAFRPG
LLAAAHHGVLYVDEVNLLHDHLVDVLLDAAAMGRVHIERDGVSHSHPARFVLVGTMNPEE
GELRPQLLDRFGLTVDVAASRNVDVRMAVVRRRLDYEADPAGFAASYAAADRAVAERILG
ARDRVAGVRLDDTELRRIAALCAAFDVDGMRADLVVARTATAHAAWRGADVVTEEDVRVA
AELALPHRRRRDPFDEPGISEEQLDDAMRDAADEVARDDAEQSVTEDETSSAGDEFESGD
ALPDAGDPPRDESGTEATETTASDESTDPDDDPGSPPDGPGGGRPAREGRTGAPVSAAAS
PPRWEVPGIGEGAPGRRSRAESRHGRVVRPSSDTGTGLHLLGTVFAAAPHQHARGRGDGP
LKLVAEDLRGAYREGREGNLVVFVVDASGSMAARDRLSAVTGAVVTLLRDAYQRRDKVAV
ITVRGQDAELVLPPTSSVDIAVRRLSGMRTGGKTPLAAGLLKAREIVQRERVRDPRRRPM
LVLLTDGRATGGADPLPRARTAAALLAQDGVTSIVVDCERGMIRLGLAAELARELRGGYL
RLAELTGDSVADIVRAGSAGARAA
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgttgtcccatgccgaaagactgtcgtcgcccgggtcgctgaccgggtcgtccacc
gacggggaggccgggttcccgttttcggccgtggtcggtcaagagcggttacagctcgcg
ttgatcctgtgcgcggtgcaccccggcatcggcggtgtgctggtgcgcggcgagaagggc
accgcgaaatcgaccgtcgtccgggcgctcgcgcagctgctgccgccggtggtggacgag
accggcgcacggcccgcgcggctggtggagctgccggtcggcgccaccgaggaccgcgtg
gtgggttcgctggatctggagcgggtgctgcgcgacggcgaacaggccttccggcccggc
ctgctggcggccgcgcaccacggcgtgctctacgtggacgaggtcaacctgctgcacgac
cacctggtcgacgtgctgctcgacgccgcggccatgggccgggtacacatcgagcgcgac
ggcgtctcgcattcgcatccggcccgattcgtgctcgtcggcacgatgaacccggaggag
ggcgagctgcgtccgcagctgctcgaccggttcgggctcaccgtcgacgtggccgcctcc
cggaacgtggacgtgcggatggccgtggtgcgccggcgactggactacgaagccgacccg
gccggttttgccgcgagctacgccgccgcggatcgcgctgtcgccgaacgcatcctgggc
gcgcgcgaccgggtggccggtgtgcgcctcgacgacaccgagctgcgccggatcgccgcg
ctgtgcgccgctttcgacgtcgacgggatgcgggccgacctggtggtggcgcgtaccgcg
accgcccacgccgcgtggcgcggggccgacgtcgtgaccgaagaagacgtgcgggtcgcc
gcggaactcgcgctgccgcaccgtcgccggcgcgatccgttcgacgaaccgggaatcagc
gaagagcagctcgacgacgcgatgcgcgacgccgccgacgaggtggcgcgcgacgacgcg
gaacaatcggtcaccgaagacgaaacatccagtgctggtgacgagttcgagtccggtgac
gctctgcctgatgcgggtgatccgccccgcgacgaatccggcacggaggcaacggaaacc
acggcgagcgacgagtcgacggaccccgacgatgatcccggctcgccgccggacggtccc
ggtggtgggcggccggcccgcgaaggccgtaccggcgcaccggtttccgccgcagcgtcg
ccgccgcgctgggaggtgcccggtatcggtgaaggcgcgcccggtcgccgctcgcgcgcg
gaatcccggcacggccgggtcgtgcggcccagctcggacaccggcaccggtctgcacctg
ctcggcaccgtcttcgccgccgcgccgcatcagcacgcccgcgggcgcggcgacgggccg
ctgaaactggtcgccgaggatctgcggggcgcgtatcgcgaagggcgcgaagggaatctg
gtcgttttcgtggtcgacgcgtccgggtcgatggcggccagggaccggttgtccgccgtc
accggcgcggtcgtgacattgctccgggacgcgtatcagcggcgcgacaaggtcgccgtg
atcaccgtgcgcggccaggacgccgaactggtgctgccgccgacctcgtccgtcgatatc
gcggtccggcggttgtccgggatgcgcaccggcggcaagacgccgctggccgccggcttg
ctcaaagcacgcgagatcgttcagcgcgaacgggtccgcgacccgcgccgccgcccgatg
ctggtgctgctcaccgacggtcgcgccaccggcggggccgatccgctgccgcgtgcccgg
accgcggccgcgctgctcgcgcaggacggcgtcacctcgatcgtcgtcgactgcgaacgc
ggcatgatccggctcgggctggccgcggaactcgcccgcgaactgcgcggcggatacctg
agactggctgagctgaccggggattcggtcgccgacatcgtgcgtgccgggtccgcgggg
gcgcgtgccgcttga

DBGET integrated database retrieval system