KEGG   Nocardia brasiliensis: O3I_031570Help
Entry
O3I_031570        CDS       T02270                                 

Definition
hypothetical protein
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
nbr  Nocardia brasiliensis
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    O3I_031570
Enzymes [BR:nbr01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     O3I_031570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7143933..7144304)
Genome map
AA seq 123 aa AA seqDB search
MPSPDELVRAMCRSWSDPDPDRIASFFAEDAVYHNIPMEPVVGRAAIRDFLVGFLATFRG
VDFDIHHQVAAGNLVMNERTDTLRTADRAIPLPVTGVFEVSDGAITAWRDYFDMGAINKA
FDL
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgccgagccccgatgaactcgtccgtgccatgtgccggagctggtcggaccccgatccg
gaccgcatcgcgtccttcttcgccgaagacgccgtctaccacaacattccgatggagccg
gtggtcggccgggccgcgatccgtgatttcctcgtcggattcctggccacctttcgaggc
gtcgatttcgacatccaccaccaggtcgcggccggcaacctggtcatgaacgagcgcacc
gacaccctgcgcaccgccgaccgtgcgattccgctcccggtcaccggcgtcttcgaagta
tccgacggcgcgatcaccgcctggcgcgactacttcgacatgggtgccatcaacaaggct
ttcgacctctga

DBGET integrated database retrieval system