KEGG   Nocardia brasiliensis: O3I_031965Help
Entry
O3I_031965        CDS       T02270                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00010  Glycolysis / Gluconeogenesis
nbr00030  Pentose phosphate pathway
nbr00051  Fructose and mannose metabolism
nbr00052  Galactose metabolism
nbr00680  Methane metabolism
nbr01100  Metabolic pathways
nbr01110  Biosynthesis of secondary metabolites
nbr01120  Microbial metabolism in diverse environments
nbr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3I_031965
   00030 Pentose phosphate pathway
    O3I_031965
   00051 Fructose and mannose metabolism
    O3I_031965
   00052 Galactose metabolism
    O3I_031965
  Energy metabolism
   00680 Methane metabolism
    O3I_031965
Enzymes [BR:nbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     O3I_031965
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     O3I_031965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AFU04342
UniProt: K0F3P6
Position
complement(7227189..7228223)
Genome map
AA seq 344 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRTANGRYGDAIVGFEDGWRGLLEDRKIQIHNDDRTDR
LLAKGGTILGTARTNPDVLRAGLGRIKRTLDDNGIDALIPIGGEGTLTAASWLSDEGVPV
VGVPKTIDNDIDCTDVTFGHDTALSIASEAIDRLHTTAESHQRVMLVEVMGRHAGWIAVN
AGMAAGAHLTLVPEVPFDVDQVCTMIKRRFQRGDKHFICVVAEGSHPAEDSGFTLRAGGI
DEFGHERFTGVAQQLGAEIERRIGKEVRTTVLGHVQRGGSPTPYDRVLATRFGLHAAEAV
HAGQFGQMVALHGSTIELVPLSEATKQLKRVPSERYQEAEAFFG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcggagttttgaccggaggcggcgactgccctggactgaacgcggtcatccgt
gctgtcgttcgcaccgcgaacggccgctacggcgacgcgatcgtcggcttcgaggacggt
tggcgtggtctattggaggatcgcaagattcagatccacaacgacgatcgcaccgatcgg
ttgctcgccaagggcggcaccatcctcggcaccgctcgcaccaatcccgacgtcctgcgc
gccggtctcggccggatcaagcgcaccctcgacgacaacggcatcgacgcgttgatcccg
atcggcggcgagggcacgctcaccgcggccagctggctgtccgacgaaggcgtgccggtg
gtcggcgtgcccaagaccatcgacaacgacatcgactgcaccgacgtgactttcggccac
gacaccgcgctgagcatcgccagcgaggcgatcgaccggctgcataccaccgcggaatcg
catcagcgcgtgatgctggtcgaggtgatgggccggcacgcgggctggatcgcggtgaac
gcgggcatggcggccggcgcacacctgacgctggtgcccgaggtgccgttcgacgtggac
caggtgtgcaccatgatcaagcgccgtttccagcgcggtgacaagcatttcatctgcgtc
gtcgccgaaggttcgcatcccgccgaggattccggcttcacgctgcgcgcgggcgggatc
gacgagttcgggcacgaacggttcaccggtgtcgcccagcaactcggcgcggagatcgaa
cgccgcatcggcaaagaggtacggaccaccgtgctcggtcacgtgcagcgcggcggcagc
ccgacgccctacgaccgcgtcctcgccacccgcttcggcctgcacgccgcggaggcggtg
cacgccggtcagttcggtcagatggtcgccctgcacggcagcaccatcgaactcgtcccg
ctctccgaggccaccaaacagctcaagcgggttccgtccgagcgctaccaggaagccgag
gcgttcttcggctga

DBGET integrated database retrieval system