KEGG   Nocardia brasiliensis: O3I_031965Help
Entry
O3I_031965        CDS       T02270                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
nbr  Nocardia brasiliensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    O3I_031965
   01230 Biosynthesis of amino acids
    O3I_031965
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3I_031965
   00030 Pentose phosphate pathway
    O3I_031965
   00051 Fructose and mannose metabolism
    O3I_031965
   00052 Galactose metabolism
    O3I_031965
  Energy metabolism
   00680 Methane metabolism
    O3I_031965
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    O3I_031965
Enzymes [BR:nbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     O3I_031965
Protein phosphatases and associated proteins [BR:nbr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     O3I_031965
Messenger RNA biogenesis [BR:nbr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     O3I_031965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7227189..7228223)
Genome map
AA seq 344 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRTANGRYGDAIVGFEDGWRGLLEDRKIQIHNDDRTDR
LLAKGGTILGTARTNPDVLRAGLGRIKRTLDDNGIDALIPIGGEGTLTAASWLSDEGVPV
VGVPKTIDNDIDCTDVTFGHDTALSIASEAIDRLHTTAESHQRVMLVEVMGRHAGWIAVN
AGMAAGAHLTLVPEVPFDVDQVCTMIKRRFQRGDKHFICVVAEGSHPAEDSGFTLRAGGI
DEFGHERFTGVAQQLGAEIERRIGKEVRTTVLGHVQRGGSPTPYDRVLATRFGLHAAEAV
HAGQFGQMVALHGSTIELVPLSEATKQLKRVPSERYQEAEAFFG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcggagttttgaccggaggcggcgactgccctggactgaacgcggtcatccgt
gctgtcgttcgcaccgcgaacggccgctacggcgacgcgatcgtcggcttcgaggacggt
tggcgtggtctattggaggatcgcaagattcagatccacaacgacgatcgcaccgatcgg
ttgctcgccaagggcggcaccatcctcggcaccgctcgcaccaatcccgacgtcctgcgc
gccggtctcggccggatcaagcgcaccctcgacgacaacggcatcgacgcgttgatcccg
atcggcggcgagggcacgctcaccgcggccagctggctgtccgacgaaggcgtgccggtg
gtcggcgtgcccaagaccatcgacaacgacatcgactgcaccgacgtgactttcggccac
gacaccgcgctgagcatcgccagcgaggcgatcgaccggctgcataccaccgcggaatcg
catcagcgcgtgatgctggtcgaggtgatgggccggcacgcgggctggatcgcggtgaac
gcgggcatggcggccggcgcacacctgacgctggtgcccgaggtgccgttcgacgtggac
caggtgtgcaccatgatcaagcgccgtttccagcgcggtgacaagcatttcatctgcgtc
gtcgccgaaggttcgcatcccgccgaggattccggcttcacgctgcgcgcgggcgggatc
gacgagttcgggcacgaacggttcaccggtgtcgcccagcaactcggcgcggagatcgaa
cgccgcatcggcaaagaggtacggaccaccgtgctcggtcacgtgcagcgcggcggcagc
ccgacgccctacgaccgcgtcctcgccacccgcttcggcctgcacgccgcggaggcggtg
cacgccggtcagttcggtcagatggtcgccctgcacggcagcaccatcgaactcgtcccg
ctctccgaggccaccaaacagctcaagcgggttccgtccgagcgctaccaggaagccgag
gcgttcttcggctga

DBGET integrated database retrieval system