KEGG   Nocardia brasiliensis: O3I_032250Help
Entry
O3I_032250        CDS       T02270                                 

Definition
hypothetical protein
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
nbr  Nocardia brasiliensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    O3I_032250
Enzymes [BR:nbr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     O3I_032250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7301851..7303455)
Genome map
AA seq 534 aa AA seqDB search
MTGAVPGQFTLVLHSHLPWLAHHGRWPVGEEWLYQSWAASYLPVAEVLRTLAAEGRSHLL
SLGITPVLAAQLDDPHCLAGMHHWLGNWQLRADEAAMAGNRALGRHEHRLATAALADFET
RWRHGAAPVWRELIDADAIELLGGPLAHPFQPLLDPRLRQFQLSEGLGDARHRWGHTPTG
IWAPECGYTPGMETGYAAAGVTHFMVDGPALRGDTTLGRPVRESDVVAFGRDLHVSYRVW
SPKSGYPGQSAYRDFHHYDHATGLKPARVTGKTVAGPDKAPYDPELAAAAVVRDVDDFVQ
TVRERLIGESERIGRPALVVAAFDTELFGHWWHEGPQWLAQVLRALPEAGVTVGTLADAR
ERGFVGAPVPLADSSWGSGKDWRVWAGDQVRDLVELNDDIVRLALDTIDKMRAADGGRGL
RDNVADQLLREAILTVSSDWAFMVSKDSAAGYARDRAHRHAHAVREIAAAVGAGQVAKAR
QLAAGWGAADGLFPGVDARRLASAGTGAHVAVPAQHAAAAGSGPVERSTAEGHA
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
ttgaccggggcggtacccggccagttcaccctggtgctgcactcgcacctgccctggctc
gcgcaccacggccgctggccggtcggcgaggaatggctctaccaatcctgggccgcctct
tatcttcccgtcgcggaagtactgagaacgcttgccgccgaaggacgttcgcacctgctc
agcctgggcatcacgccggtgctcgccgcacagctggacgacccgcactgcctcgcaggc
atgcaccactggctcggcaactggcagctgcgcgccgacgaggccgcgatggcgggcaat
cgcgcgctcggccggcacgaacatcgtttggccacagcggcgctcgcggatttcgaaaca
cgctggcggcacggcgcggcaccggtctggcgcgaactcatcgacgccgacgccatcgaa
ctgctcggcggaccgctcgcgcacccgttccagccgctgctcgacccgcggctgcgtcag
ttccagctcagcgagggcctcggcgacgcacggcatcgctggggccacacccccaccggc
atctgggcgcccgaatgcggttacacccccggcatggagacgggctacgccgccgcgggt
gtgacgcatttcatggtcgacgggcccgccctgcgcggcgacaccaccctcgggcggccg
gttcgcgagtcggacgtggtcgcgttcggccgcgatctgcacgtcagctatcgggtgtgg
tcgccgaagtccggctatcccgggcagagcgcctaccgtgactttcatcactacgaccac
gcgacgggcctcaagcccgcgcgggtcaccggcaagacggtggccggtccggacaaggcg
ccctacgaccccgaactcgccgccgcggcggtggtgcgcgatgtggatgatttcgtccag
acggtccgcgagcgactgatcggcgaatccgagcggatcggccggcccgcgttggtggtg
gccgcgttcgacaccgaattgttcggccactggtggcacgagggtccgcagtggttggcc
caggtgttgcgggccctgcccgaagcgggcgtcaccgtcggcacgctcgccgacgccagg
gaacgcggattcgtcggtgcgcctgtgcctttggcggattcgtcgtggggttccggcaaa
gactggcgggtctgggccggtgaccaggtgcgcgacctggtggaactcaacgacgacatc
gtgcggctcgccctcgacaccatcgacaagatgcgggccgccgacggtggccgcggactc
cgcgacaacgttgccgaccagttgcttcgcgaggcgatcctcaccgtgtccagcgactgg
gccttcatggtcagcaaggactccgccgcgggctacgcgcgcgaccgcgcacaccggcac
gcgcacgccgtgcgggagatcgcggccgccgtcggcgcgggccaagtcgccaaagcacgg
caattggcggcaggatggggggcggctgacggactgttcccgggtgtggacgcccggcgg
ctcgcgagcgccggaaccggagcacatgtcgcagtgcctgcccagcacgccgccgccgca
ggatcgggccccgttgaacggtccaccgcagaaggacatgcatga

DBGET integrated database retrieval system