KEGG   Nocardia brasiliensis: O3I_034330Help
Entry
O3I_034330        CDS       T02270                                 

Definition
dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nbr  Nocardia brasiliensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    O3I_034330
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3I_034330
  Lipid metabolism
   00071 Fatty acid degradation
    O3I_034330
  Amino acid metabolism
   00350 Tyrosine metabolism
    O3I_034330
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    O3I_034330
   00626 Naphthalene degradation
    O3I_034330
Enzymes [BR:nbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     O3I_034330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7750583..7751626
Genome map
AA seq 347 aa AA seqDB search
MMRALQLTGPGVVELREVPVPEIGSGELLLRVGAAGICHSDLHVLHLPFRLRTEPLTLGH
EVAGTIEAVGEAVEGRSAGERGVVYLCWSCGRCRECVSGNENVCLAAGRTAMPPCPGLGP
DGGMAEYLRMPADAFVPIGDLDFRQAAPLADAALTSYHAIRGAREQLRPGSVAVVIGVGG
LGHAAVQILTATSATEVLAVDVAADKLELATRGGAAAGLRAGPGTAQQILDRTDGRGADA
VFDFVGNDQTCALAVATVAPNGAYRMIGLGGGTPEITAAPAGGPGWPWGASIRKSYGGTK
SDLIESVALARSGKLEIAVEQYALADGRAALDRLERGLVTGRAVVVP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgcgccttgcagctcaccggtcccggcgtcgtcgagctgcgcgaggtaccggtc
cccgagatcgggtcgggcgagctgctgctgcgggtcggcgcggccgggatctgccattcc
gatctgcatgtgctgcacctgccgttccggctgcgcacggagccgctgacactcggacac
gaagtcgcgggaaccatcgaggcggtcggcgaggcggtcgaaggccgcagcgccggcgaa
cgcggcgtcgtctacctgtgctggtcgtgcggccggtgccgagagtgcgtgtccggcaac
gagaacgtctgcctggccgcgggccgcaccgcgatgccgccgtgccccgggctcggtccg
gacgggggcatggccgagtacctgcgcatgccggccgacgcgttcgtgccgatcggcgat
ctcgatttccggcaggccgctccgctcgcggacgcggcactgaccagctaccacgcgatc
cgcggtgcacgcgagcagttgcggccgggctcggtggcagtggtgatcggcgtcggcggg
ctggggcacgcggcggtgcagatcctcaccgcgaccagcgcgaccgaggtgctcgcggtc
gacgtcgccgcggacaagctggaattggcgacgcgcggtggcgcggccgcagggctgcgg
gccggaccgggcaccgcgcagcagatcctcgaccgcaccgacggccgtggcgccgacgcg
gtattcgacttcgtcggcaacgaccagacctgcgcgctcgccgtcgccacggtcgcgccg
aacggcgcctaccggatgatcggcctgggcggcggcacgccggagatcaccgcggcgccc
gcgggcggcccgggctggccgtggggtgcctcgatccgaaagtcgtacggcggcaccaaa
tccgatctgatcgagtccgtcgcgctggctcgttcgggcaagctcgagatcgcggtcgag
cagtacgcactggccgacgggcgcgcggcgctcgaccggctcgagcgtgggctggtcacc
ggtcgcgcggtagtggttccatga

DBGET integrated database retrieval system