KEGG   Nocardia brasiliensis: O3I_034820Help
Entry
O3I_034820        CDS       T02270                                 

Definition
bifunctional uroporphyrinogen-III synthetase/response regulator domain protein (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nbr  Nocardia brasiliensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    O3I_034820
Enzymes [BR:nbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     O3I_034820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7859124..7860380)
Genome map
AA seq 418 aa AA seqDB search
MGGGGRATGGSTPDASACLAGFTIGITAARRADEFATLLVRRGAGVVFAPAIRIIPLADD
DELARVTRQLVVDPPQIVVATTGIGFRGWMEAAEGWGVAEQLRTTLASTRVLARGPKAKG
AIRAAELREEWSPASESSAEVLDHLLAEGVDGVRIAVQLHGATTEWEPVPDFCEVLRCAG
ADVVPVPVYRWEPPPDQQPMDQLIEAIVTSSLDCVTFTSAPAVASMLMRAKETGLLDGLL
HALRGRVLAACVGPITAAPLEELGVPTSMPGRARLGALARHVAEELPRRANRIYAAGHTL
SVRGGCVVVDGEVRQLAPAPMALMRSLARQPGRVVSREHLLAALPGGGDDTHAVETAIAR
LRAGLGAPKAIQTVVKRGYRLAMDAAECVDNNPRPELGGPQMPGFGTPLRHAQTMGAW
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggggggcggtggccgggcgacgggcgggtcaactcccgatgcaagcgcctgtctcgcg
ggattcaccatcggcatcacggcggcgcgacgcgccgacgagttcgccaccctgctggtc
cgccggggcgccggcgtggtgttcgcccccgccattcgcatcattccgctcgccgacgac
gacgaactggcgcgggtgacccgccagctggtcgtggatcccccgcagatcgtggtggcc
accaccggcatcggcttccgcggctggatggaggcggccgagggctggggtgtcgcggag
caactgcggaccaccctcgcgtccacccgggtgctggcgcgcggcccgaaggccaagggc
gccatccgcgcggccgaactgcgcgaggagtggtcgcccgcgtccgagtcctcggccgag
gtgctcgatcatctgctcgccgagggtgtggacggggtgcggatcgcggtgcagctgcac
ggcgcgaccaccgagtgggagccggtgcccgacttctgcgaggtattgcgttgcgccggt
gcggatgtcgtgccggtgccggtgtatcgctgggagccgccgccggatcagcagccgatg
gaccagctgatcgaggccatcgtcacctccagcctggactgcgtcacgttcaccagtgcg
cccgccgtcgcgtcgatgttgatgcgcgccaaggaaaccggactgctcgacgggctgttg
cacgcgctgcgcggccgggtgctggccgcatgcgtcgggccgatcaccgcggcgccgctg
gaggaactcggcgtgccgacctccatgccggggcgggcccgcctcggtgcgctggcccgg
cacgtcgccgaggaactgccgcgccgggccaatcggatctacgccgcgggccacacgctg
agcgtgcgcggcggctgcgtggtggtcgacggcgaggtgcgccagctggcgcccgcgccg
atggcgctgatgcggtcgctggccaggcagcccggccgggtggtttcccgggagcacctg
ctcgccgcgctgcccggcggcggggacgacacgcacgcggtggaaaccgcgatcgcccgg
ctgcgcgccggactcggtgcgccgaaggcgatccagaccgtggtcaagcgcggctaccgg
ctggccatggacgcggccgaatgcgtcgacaacaacccgcggcccgaactcggcgggccg
cagatgcccggtttcggtacaccgctgcggcacgcccagaccatgggggcgtggtga

DBGET integrated database retrieval system