KEGG   Nocardia brasiliensis: O3I_035840Help
Entry
O3I_035840        CDS       T02270                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
nbr  Nocardia brasiliensis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:nbr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8078373..8079257)
Genome map
AA seq 294 aa AA seqDB search
MFSATVSPLPTLCGKPVATDRALVMAIVNRTPDSFYDRGATFTDAAAMDAVVRAVDEGAD
LVDIGGVKAGPGSLVDAEEEARRVLPFVAAIRAKFPELLISIDTWRAEVALAAVREGADL
INDTWAGADPELVPVAAEQGVGLVCSHTGGAVPRTRPHRVRYADILAEVTATLVRAAEHA
AAAGVRADSILIDPTHDFGKNTYHGLELLRGVDVLVNTGWPVLMALSNKDFIGETLGVDL
SERLEGTLAATAWSAAAGARVFRVHEVAATRRVVDMIAAIQGIRPPARTLRGLV
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgttcagcgccaccgtttcaccgcttccgaccttgtgcggcaagccggtggcgacggat
cgggcgctggtgatggcgatcgtgaatcggacgccggattccttttatgaccggggtgcg
acgttcaccgacgccgccgcgatggacgcggtcgtgcgcgcggtggacgagggcgccgac
ctggtcgacatcggcggggtgaaggccgggccggggtcgctggtcgatgccgaggaggag
gcccggcgggtactcccgttcgtcgccgcgatccgcgcgaagtttccggagctattgatc
agcatcgatacctggcgcgccgaggtggcgctggccgccgtgcgcgaaggcgcggacctg
atcaacgacacctgggcgggcgccgatccggagctggtgccggtggcggccgagcagggt
gtcggcctcgtgtgcagccacaccggcggcgcggtgccgcgcacccggccgcaccgggtg
cgctacgccgatattctggccgaagtgaccgccaccctggtgcgggcggccgagcacgcg
gccgcggcgggggtgcgcgcggattcgatcctgatcgatccgacccatgatttcggcaag
aacacctatcacggcctggagttgttgcgcggagtggacgttcttgtaaataccgggtgg
ccggtcctgatggccctcagcaataaggatttcatcggggagactctaggtgtcgatctt
tccgagcggttggagggcacattggcggcaacagcatggtcggctgccgccggcgcccgc
gtcttccgcgttcacgaagtcgccgcgacccggcgggtagtggacatgatcgccgccatc
cagggcatccggcccccagcacgcaccctgcgaggtttggtatga

DBGET integrated database retrieval system