KEGG   Nocardia brasiliensis: O3I_036280Help
Entry
O3I_036280        CDS       T02270                                 

Definition
putative limonene-1,2-epoxide hydrolase
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
nbr  Nocardia brasiliensis
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Limonene and pinene degradation [PATH:nbr00903]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8169267..8169683)
Genome map
AA seq 138 aa AA seqDB search
MTQDLDLQQDAITTVREFFSALELGAVAEALELLHPDVVWKNSTLPAVGGGLTRKILRGL
ERDAFGFEVQIHHIAADGAFVLTDRTDVLRVGPVRVAFWVMGTLEVRDGRIILWDDHFSW
ENLLRGTVAGLARAALSR
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggacctcgaccttcagcaggacgcgatcaccacggtgcgggagttcttctcc
gcgctcgagctaggcgccgtcgccgaggcgctggaactgctgcaccccgacgtggtctgg
aagaactccacgctgcccgctgtcggcggcgggctgacgcgcaagatcctgcgcggactg
gagcgcgacgccttcggcttcgaggtgcagatccatcacatcgccgccgacggcgctttc
gtgctcaccgatcgcaccgacgtgctgcgggtcggccccgtgcgggtggcgttctgggtg
atgggcacactcgaggtgcgcgacggccgaatcatcctgtgggacgaccacttcagctgg
gagaacctgctgcgcggcacggtcgccggcctcgcgcgggccgcgctgtcacgctga

DBGET integrated database retrieval system