KEGG   Nocardia brasiliensis: O3I_036515Help
Entry
O3I_036515        CDS       T02270                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
nbr  Nocardia brasiliensis
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Module
C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    O3I_036515
   00630 Glyoxylate and dicarboxylate metabolism
    O3I_036515
   00640 Propanoate metabolism
    O3I_036515
   00650 Butanoate metabolism
    O3I_036515
  Lipid metabolism
   00071 Fatty acid degradation
    O3I_036515
   00072 Synthesis and degradation of ketone bodies
    O3I_036515
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    O3I_036515
   00310 Lysine degradation
    O3I_036515
   00380 Tryptophan metabolism
    O3I_036515
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    O3I_036515
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    O3I_036515
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    O3I_036515
Enzymes [BR:nbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     O3I_036515
Exosome [BR:nbr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   O3I_036515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
8211948..8213168
Genome map
AA seq 406 aa AA seqDB search
MPEAVIVSTARSPIGRAAKGSLVDMRPDDLTTQIVRAALDKVPALDPNQIDDLILGCGSP
GGESGFNMARIVAVQLGYDLVPGTTVHRYCASSLQSTRMAFHAIKAGEGEVFISAGVETV
SRYKNGSADSWPNTQNELFAEAQARTAKTAEGGAGAWHDPRQDGLIPDAYIAMGQTAENV
AGFTGITREEQDRWGVRSQNRAEEAIKNGFFEREITPITLPDGTVVSKDDGPRAGVTYEA
VSQLKPVFRPDGTVTAGNCCPLNDGAAALVIMSDTKAKELGLTPLARIVSTGVSGLSPEI
MGLGPIEACKRALALAGKSIDDIDLVEINEAFAVQVLGSARELKIDEDKLNVSGGAIALG
HPFGMTGARITTTLLNNLQTYDKQFGLETMCVGGGQGMAMVIERLS
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaggctgtcatcgtctcgactgcccgttccccgatcggccgggcggccaaggga
tcgctggtcgacatgcggcccgacgacctgaccacccagatcgtccgcgcggcactcgac
aaggtgcccgctctggaccccaaccagatcgatgacctgattctcggctgcggttcgccg
ggtggcgagtccggtttcaacatggcccgcatcgtcgccgtgcagctgggttacgacctg
gtgccgggcaccaccgtgcaccgctactgcgcgtcgtcgttgcagtccacccggatggcc
ttccacgccatcaaggcgggcgagggtgaggtgttcatctccgcgggcgtcgagaccgtg
tcccggtacaagaacggttccgccgacagctggccgaacacgcagaacgagctcttcgcc
gaggcgcaggcgcgcaccgcgaagaccgccgagggcggcgcgggcgcgtggcacgacccg
cgccaggacggcctgatcccggacgcctacatcgcgatgggccagaccgcggagaacgtc
gccggcttcaccggtatcacccgtgaggagcaggatcgctggggcgtgcggtcgcagaac
cgggccgaggaagcgatcaagaacggcttcttcgagcgcgagatcaccccgatcacgctg
cccgacggcactgtggtgtcgaaggacgacggcccgcgcgcgggcgtcacctacgaggcg
gtcagccagctgaagccggtcttccgcccggacggcacggtcaccgccggtaactgctgt
ccgctcaacgacggcgccgccgcgctcgtcatcatgagcgacaccaaggccaaggaactg
ggcctgaccccgctggcccgcatcgtctccaccggcgtctccggcctgtcgcccgagatc
atgggtctcggcccgatcgaggcatgcaagcgcgcactcgccttggcgggcaagtcgatc
gacgatatcgacctggtcgagatcaacgaggcgttcgcggtgcaggtgctcggttcggct
cgcgagctgaagatcgacgaggacaagctgaacgtctccggcggcgcgatcgcgctcggc
cacccgttcggcatgaccggcgcccgtatcaccaccacgctgctcaacaacctgcagacc
tacgacaagcagttcggtctggagaccatgtgcgtcggcggcggccagggcatggcgatg
gtcatcgagcgcctgagctag

DBGET integrated database retrieval system