KEGG   Nocardia brasiliensis: O3I_037460Help
Entry
O3I_037460        CDS       T02270                                 

Definition
(GenBank) putative UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00040  Pentose and glucuronate interconversions
nbr00052  Galactose metabolism
nbr00500  Starch and sucrose metabolism
nbr00520  Amino sugar and nucleotide sugar metabolism
nbr01100  Metabolic pathways
nbr01130  Biosynthesis of antibiotics
Module
nbr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    O3I_037460
   00052 Galactose metabolism
    O3I_037460
   00500 Starch and sucrose metabolism
    O3I_037460
   00520 Amino sugar and nucleotide sugar metabolism
    O3I_037460
Enzymes [BR:nbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     O3I_037460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Imm75
Motif
Other DBs
NCBI-ProteinID: AFU05439
UniProt: K0F6W9
Position
complement(8403167..8404123)
Genome map
AA seq 318 aa AA seqDB search
MTAKAGQPGDAAPASCFRTAVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEAAG
SGAQRLVIVTSPGKDGVVAHFVEDLVLEGTLAERGKFQLLEKVRKAPGLLDVTSVVQEEP
LGLGHAVAQAEAALDDDEDAIAVLLPDDLVLPSGVLDVMCRVRRKRGGTVLCAIDVPKDE
VSAYGVFDVATVPDAVNPNVLRVKGMVEKPALADAPSTFAAAGRYLLDRAIFDALRRIEP
GAGGELQLTDAVALLIAEGHPVHVVVHRGSRHDLGNPGGYLRAAVDFALERDEYGPALRE
WLQHRLGPDWDPQLTTYE
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaaaggccggacaacccggcgatgccgcgccggcatcgtgcttccgcacggcc
gtagtacccgcggccgggctcggcacacggttcttgcccgcgacgaagaccgtgcccaaa
gagctgctgccggtggtcgatacccccggcatcgagctggtcgccgccgaggccgcgggc
tccggcgcgcagcggttggtgatcgtcacctcaccgggcaaagacggtgtggtcgcgcac
ttcgtcgaggacctggtgctggagggcaccctggccgagcgcggcaagttccagctgctg
gagaaggtgcgcaaggcgcccggcctgctcgacgtcacctcggtggtgcaggaggaaccg
ctgggcctcggtcacgcggtcgcccaggccgaggccgcgctggacgacgacgaagacgcc
atcgccgtgctgctgccggatgatctggtgctgccctccggcgtgctcgacgtgatgtgc
cgggtccgccgcaagcgcggcggcaccgtgctgtgcgccatcgacgtgccgaaggacgag
gtcagcgcctacggcgttttcgatgtggcgaccgtgccggacgcggtgaatccgaatgtg
ctgcgggtcaagggcatggtggagaagcccgccctcgccgacgcgccgtccacgttcgcc
gcggcgggccgatacctgctggaccgcgcgatcttcgacgcgttgcgccggatcgagccg
ggcgccgggggtgaattgcagctcaccgacgcggtcgcgctgctgatcgccgagggacat
ccggttcatgtcgtggtgcaccgtgggtcgcgccacgatttggggaacccgggcggctat
cttcgtgctgcggtcgatttcgctttggaacgcgacgaatacggccctgccctgcgggag
tggctgcaacatcggctcggtcccgactgggatccgcagctgacgacctacgagtag

DBGET integrated database retrieval system