KEGG   Nocardia brasiliensis: O3I_037955Help
Entry
O3I_037955        CDS       T02270                                 

Definition
dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
nbr  Nocardia brasiliensis
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:nbr00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:nbr00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8545733..8546479
Genome map
AA seq 248 aa AA seqDB search
MTDLTGRSALITGGAGGIGAACARELAARGALVTIADIDDVGAKSLARELGGKPWAVDLL
DVEALTSLTLEVDILVNNAGVQSISPIEDFAPQQFRNLLTLMVEAPFLLIRAALPHMYRQ
GFGRIVNISSVHGLRASEFKSAYVTAKHGLEGLSKVTALEGGKHGVTSNCVNPGYVRTPL
VDKQIADQAKAHDIPEQQVLEKILLTESAIKRLVEPEEVAALVGWLTSPHAGMVTGASYT
MDGGWSAR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacctgacaggacgttccgcgctgatcacgggcggcgccggcggcatcggcgcg
gcctgcgcccgggaactggccgcgcggggcgccctggtcaccatcgccgatatcgacgat
gtcggggccaagtcgctcgcccgcgaactcggcggaaaaccttgggccgtcgacctactc
gacgtcgaggccttgacctcgctgacgctcgaggtggacatcctggtgaacaacgccggc
gtgcagagcatcagcccgatcgaggatttcgcgccgcagcagttccggaacctgctcacc
ctgatggtcgaggcgccgttcttgctcatccgtgccgcgctgccgcacatgtaccggcag
ggtttcggccggatcgtcaatatctcgtcggtgcacggacttcgagcctcggagttcaag
tccgcctacgtgaccgccaaacatggactggagggcctgtccaaggtcaccgcgctcgaa
ggcggcaagcacggcgtcacgagcaactgcgtcaaccccggctatgtgcgaactccgctg
gtggacaagcagatcgccgatcaggccaaggcgcacgacattccggaacagcaggtgctg
gagaagatcctgctcaccgagagcgcgatcaaacgcctggtggagccggaagaggtggcc
gcactggtgggttggctcacctcgccgcacgcgggcatggtgaccggcgcgtcctacacc
atggacggcgggtggagcgctcgatga

DBGET integrated database retrieval system