KEGG   Nocardia brasiliensis: O3I_038815Help
Entry
O3I_038815        CDS       T02270                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
nbr  Nocardia brasiliensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    O3I_038815
Enzymes [BR:nbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     O3I_038815
Exosome [BR:nbr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   O3I_038815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8705998..8706966)
Genome map
AA seq 322 aa AA seqDB search
MDRPRRLRRTPALRRLVAETTLEPRQLVLPMFVADGLEEPREISSMPGVVQHSMDSLRKA
AVEAVTAGVGGLMLFGIPRPEDKDATGSQASDPDGILNRGLRALSDEVGSATVLMADTCL
DEFTDHGHCGVVAADGSVDNDATLHRYVEMALAQAAAGADLLGTSGMMDGQVGAIRRGLD
AVGRTDTGILAYAAKYASAFYGPFREAVASSLEGDRRTYQQDPANRREAIRELDLDLAEG
ADLVMVKPAMSYLDILRDVADHSPVPVAAYQISGEYAMITAAAERGWIDRRGAVLESLMG
IRRAGADIVLTYWATEAAHWLS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcccacggcggttgcgccgtacccccgccctgcgtcgactcgtggccgaaacc
acactggagccacggcaattggtgttgccgatgttcgtggccgacggcctggaagagccg
cgggaaatcagttccatgccgggggtcgtgcagcattcgatggactcgctgcgcaaggcc
gccgtcgaggcggtgaccgcgggcgtcggcgggctcatgctgttcggcatcccgcgcccg
gaggacaaggacgccaccggcagccaggccagtgatccggacggcattctgaaccgcggt
ctgcgggcgctgtccgacgaggtcggctcggccaccgtgctcatggccgacacctgtctc
gacgagttcaccgaccacgggcactgcggtgtggtcgccgccgacggatccgtggacaac
gacgccaccctgcaccgctacgtcgagatggcgctggcccaggccgccgccggcgccgat
ctgctcggcaccagcggcatgatggacggccaggtcggcgcgatccgccgcggcctggac
gcggtgggccgcaccgataccggcatcctggcctacgccgccaagtacgcctcggcgttc
tacggcccgttccgtgaggccgtcgcctcctcgctggagggcgaccggcgcacctaccag
caggacccggcgaaccgccgcgaagcgatccgggaactggacctcgacctcgccgagggc
gcggacctggtgatggtgaagccggccatgtcgtacctggacatcctgcgcgacgtcgcc
gaccattcgccggtgccggtcgccgcctaccagatctccggcgagtacgcgatgatcacc
gccgccgccgagcggggctggatcgaccgccgcggcgccgtgctcgaatcgctcatgggc
atccgccgggccggtgcggacatcgtgctcacctactgggcgaccgaggccgcacactgg
ttgtcgtga

DBGET integrated database retrieval system