KEGG   Nocardia brasiliensis: O3I_038955Help
Entry
O3I_038955        CDS       T02270                                 

Definition
putative sugar kinase, Glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
nbr  Nocardia brasiliensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    O3I_038955
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3I_038955
   00052 Galactose metabolism
    O3I_038955
   00500 Starch and sucrose metabolism
    O3I_038955
   00520 Amino sugar and nucleotide sugar metabolism
    O3I_038955
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    O3I_038955
   00524 Butirosin and neomycin biosynthesis
    O3I_038955
Enzymes [BR:nbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     O3I_038955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8736047..8736952)
Genome map
AA seq 301 aa AA seqDB search
MTVLALDIGATKFAAGIAQADRTVGGVRQVQVPAEAVWEACRALLLEVAGETTITAVGIG
SAGPVDTRTGVTSPLNIPEWKAGFPIVASVQEVFPGATIHFAIDGACLALAEHHVGALRG
VPNGLALTVSSGIGGGIIADGRVLLGRTGNAGHIGHIVVPGWDVPCRCGGIGCVEAVASG
MSSVRWAVEQGWPGSTGVQLAEDARRGERIALAALHRAGTALGQAIASACALLDVDRVVI
GGGFAQSGAPLWDPLRAALRKHARLDFTREISVVLSEVTNGATLVGAGVLAAGHATADAA
G
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgacagttctcgctctcgatatcggcgcgacgaagttcgcggcgggtatcgcgcaggcc
gaccggacggtgggcggggtgcggcaggtccaggtgccggccgaggcggtgtgggaggcg
tgccgcgcgctgctgctcgaggtggcgggggagacgacgatcaccgccgtcgggatcggc
tcggccgggccggtggacacgcgcaccggcgtcaccagcccgctgaacatcccggaatgg
aaagcgggcttcccgatcgtcgcttcggtgcaggaggtgttccccggcgccacgatccac
ttcgccatcgacggcgcctgcctcgcgctggccgagcatcacgtcggcgcgctgcgcggg
gtgccgaacgggttggcgctcaccgtgtcctcggggatcggcggcgggatcatcgcggac
ggacgggtactgctcggccgcaccggcaacgccggtcacatcggtcatatcgtggtcccc
ggctgggacgtgccctgccggtgcggcggtatcggctgcgtggaagcggtcgccagcgga
atgtcgtcggtgcgctgggcggtcgaacagggctggcccggtagtaccggcgtgcaactg
gccgaggacgcgcgccggggcgagcggatcgcgctcgcggcgctgcaccgcgcgggcacc
gcgctcggtcaggcgatcgcctcggcgtgcgcgctgctcgacgtcgaccgggtggtgatc
ggcggcggtttcgcgcaatccggtgcgccgctgtgggatccgttgcgcgcggcgctgcgc
aagcacgcgcgcctcgatttcacccgggagatcagtgtcgtgctctccgaagtgaccaac
ggcgccacgctggtcggcgcgggcgtgctcgcggcgggccacgccaccgccgacgccgcg
ggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system