KEGG   Nocardia brasiliensis: O3I_039370Help
Entry
O3I_039370        CDS       T02270                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00010  Glycolysis / Gluconeogenesis
nbr00052  Galactose metabolism
nbr00500  Starch and sucrose metabolism
nbr00520  Amino sugar and nucleotide sugar metabolism
nbr00521  Streptomycin biosynthesis
nbr01100  Metabolic pathways
nbr01110  Biosynthesis of secondary metabolites
nbr01120  Microbial metabolism in diverse environments
nbr01130  Biosynthesis of antibiotics
nbr01200  Carbon metabolism
Module
nbr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nbr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3I_039370
   00052 Galactose metabolism
    O3I_039370
   00500 Starch and sucrose metabolism
    O3I_039370
   00520 Amino sugar and nucleotide sugar metabolism
    O3I_039370
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    O3I_039370
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    O3I_039370
Enzymes [BR:nbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     O3I_039370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: AFU05821
UniProt: K0FDU0
Position
8821535..8822680
Genome map
AA seq 381 aa AA seqDB search
MSAEHDPKSTDRPGRAAAGSPDQAATAAEVGAGAAAHSTTPSAGAARPAIGAAGPTATAR
PGGPSTGQTAAPARPAPLPDDALVLGLDVGGTTIKGEITDRAGEVLAVATVATPQGEAAF
EAMGALGDQLLAELTAAHRDRVGRAAVVLPGIVDSVRSIAVFSSNVGWRDVHIGDRFRDR
WGIPVLIEHDVAVAGWAEWRFGAGRGHDNVCVVILGTGISGTLSVGGHLVRSSYGQVGEY
GHIPVRPDGLPCPCGNTGCVETVASGASIARAYTRRTGREIKGAAEVFALVDTDPDAKAV
LVDAVDALADGLIGIVHAACPELIILGGGLAGAGAALTDPLHQAIADRLRLVPAPHVVLG
EYGARAGLMGAALFARQGSLA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccgagcacgacccgaagagcacagaccggcccggccgcgccgcggccggatcg
cccgaccaggccgctaccgcggccgaggtgggcgcgggcgccgctgcgcacagcacgacg
ccctcggccggtgccgccaggcccgcgatcggcgctgccgggccgaccgcgacggctcgt
cctggtggcccgtcgacggggcagaccgccgcacccgcgcggcctgccccgttgcccgac
gacgcactggtcctcgggctggacgtcggcggcaccacgatcaaaggcgaaatcaccgac
cgcgcaggcgaagtgctcgccgtcgcgaccgtggccacgccgcagggcgaggcggcgttc
gaggcgatgggcgcgctcggcgatcaactgctggccgaactgaccgcggcccaccgggat
cgggtcggccgcgcggccgtggtcctgcccgggatcgtcgattccgtccgctcgatcgcg
gtgttcagcagcaatgtcggctggcgggacgtgcacatcggcgaccggttccgcgaccgc
tggggcatccccgtgctcatcgaacacgatgtcgccgtggcgggttgggccgaatggcgc
ttcggcgcgggtcgcgggcacgacaacgtctgcgtcgtcatcctgggcaccggcatctcc
ggcacgctgtccgtcggcgggcacctggtgcgcagcagctacggccaggtcggcgaatac
gggcatatcccggtgcgcccggacgggctgccctgcccgtgcggcaacaccggctgcgtg
gagaccgtggcctccggcgcgtcgatcgcccgcgcctacacccgccgcaccggtcgcgag
atcaagggcgcggcagaggttttcgcgctggtcgacaccgaccccgatgccaaggccgtg
ctcgtggacgcggtggacgcgctggccgacggactgatcggcatcgtgcacgcggcctgc
ccggagctgatcatcctcggcggcggcctcgccggtgcgggcgcggccctcaccgacccg
ctgcaccaagccatcgccgaccgcctccgcctggtacccgcaccgcacgtcgtgctcggc
gaatacggcgcccgcgccgggctgatgggtgccgcgttgttcgcccggcaaggttcgctg
gcatga

DBGET integrated database retrieval system