KEGG   Nocardia brasiliensis: O3I_039370Help
Entry
O3I_039370        CDS       T02270                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
nbr  Nocardia brasiliensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    O3I_039370
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3I_039370
   00052 Galactose metabolism
    O3I_039370
   00500 Starch and sucrose metabolism
    O3I_039370
   00520 Amino sugar and nucleotide sugar metabolism
    O3I_039370
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    O3I_039370
   00524 Butirosin and neomycin biosynthesis
    O3I_039370
Enzymes [BR:nbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     O3I_039370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8821535..8822680
Genome map
AA seq 381 aa AA seqDB search
MSAEHDPKSTDRPGRAAAGSPDQAATAAEVGAGAAAHSTTPSAGAARPAIGAAGPTATAR
PGGPSTGQTAAPARPAPLPDDALVLGLDVGGTTIKGEITDRAGEVLAVATVATPQGEAAF
EAMGALGDQLLAELTAAHRDRVGRAAVVLPGIVDSVRSIAVFSSNVGWRDVHIGDRFRDR
WGIPVLIEHDVAVAGWAEWRFGAGRGHDNVCVVILGTGISGTLSVGGHLVRSSYGQVGEY
GHIPVRPDGLPCPCGNTGCVETVASGASIARAYTRRTGREIKGAAEVFALVDTDPDAKAV
LVDAVDALADGLIGIVHAACPELIILGGGLAGAGAALTDPLHQAIADRLRLVPAPHVVLG
EYGARAGLMGAALFARQGSLA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccgagcacgacccgaagagcacagaccggcccggccgcgccgcggccggatcg
cccgaccaggccgctaccgcggccgaggtgggcgcgggcgccgctgcgcacagcacgacg
ccctcggccggtgccgccaggcccgcgatcggcgctgccgggccgaccgcgacggctcgt
cctggtggcccgtcgacggggcagaccgccgcacccgcgcggcctgccccgttgcccgac
gacgcactggtcctcgggctggacgtcggcggcaccacgatcaaaggcgaaatcaccgac
cgcgcaggcgaagtgctcgccgtcgcgaccgtggccacgccgcagggcgaggcggcgttc
gaggcgatgggcgcgctcggcgatcaactgctggccgaactgaccgcggcccaccgggat
cgggtcggccgcgcggccgtggtcctgcccgggatcgtcgattccgtccgctcgatcgcg
gtgttcagcagcaatgtcggctggcgggacgtgcacatcggcgaccggttccgcgaccgc
tggggcatccccgtgctcatcgaacacgatgtcgccgtggcgggttgggccgaatggcgc
ttcggcgcgggtcgcgggcacgacaacgtctgcgtcgtcatcctgggcaccggcatctcc
ggcacgctgtccgtcggcgggcacctggtgcgcagcagctacggccaggtcggcgaatac
gggcatatcccggtgcgcccggacgggctgccctgcccgtgcggcaacaccggctgcgtg
gagaccgtggcctccggcgcgtcgatcgcccgcgcctacacccgccgcaccggtcgcgag
atcaagggcgcggcagaggttttcgcgctggtcgacaccgaccccgatgccaaggccgtg
ctcgtggacgcggtggacgcgctggccgacggactgatcggcatcgtgcacgcggcctgc
ccggagctgatcatcctcggcggcggcctcgccggtgcgggcgcggccctcaccgacccg
ctgcaccaagccatcgccgaccgcctccgcctggtacccgcaccgcacgtcgtgctcggc
gaatacggcgcccgcgccgggctgatgggtgccgcgttgttcgcccggcaaggttcgctg
gcatga

DBGET integrated database retrieval system