KEGG   Nocardia brasiliensis: O3I_039370Help
Entry
O3I_039370        CDS       T02270                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
nbr  Nocardia brasiliensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:nbr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:nbr00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:nbr00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:nbr00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:nbr00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:nbr00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8821535..8822680
Genome map
AA seq 381 aa AA seqDB search
MSAEHDPKSTDRPGRAAAGSPDQAATAAEVGAGAAAHSTTPSAGAARPAIGAAGPTATAR
PGGPSTGQTAAPARPAPLPDDALVLGLDVGGTTIKGEITDRAGEVLAVATVATPQGEAAF
EAMGALGDQLLAELTAAHRDRVGRAAVVLPGIVDSVRSIAVFSSNVGWRDVHIGDRFRDR
WGIPVLIEHDVAVAGWAEWRFGAGRGHDNVCVVILGTGISGTLSVGGHLVRSSYGQVGEY
GHIPVRPDGLPCPCGNTGCVETVASGASIARAYTRRTGREIKGAAEVFALVDTDPDAKAV
LVDAVDALADGLIGIVHAACPELIILGGGLAGAGAALTDPLHQAIADRLRLVPAPHVVLG
EYGARAGLMGAALFARQGSLA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccgagcacgacccgaagagcacagaccggcccggccgcgccgcggccggatcg
cccgaccaggccgctaccgcggccgaggtgggcgcgggcgccgctgcgcacagcacgacg
ccctcggccggtgccgccaggcccgcgatcggcgctgccgggccgaccgcgacggctcgt
cctggtggcccgtcgacggggcagaccgccgcacccgcgcggcctgccccgttgcccgac
gacgcactggtcctcgggctggacgtcggcggcaccacgatcaaaggcgaaatcaccgac
cgcgcaggcgaagtgctcgccgtcgcgaccgtggccacgccgcagggcgaggcggcgttc
gaggcgatgggcgcgctcggcgatcaactgctggccgaactgaccgcggcccaccgggat
cgggtcggccgcgcggccgtggtcctgcccgggatcgtcgattccgtccgctcgatcgcg
gtgttcagcagcaatgtcggctggcgggacgtgcacatcggcgaccggttccgcgaccgc
tggggcatccccgtgctcatcgaacacgatgtcgccgtggcgggttgggccgaatggcgc
ttcggcgcgggtcgcgggcacgacaacgtctgcgtcgtcatcctgggcaccggcatctcc
ggcacgctgtccgtcggcgggcacctggtgcgcagcagctacggccaggtcggcgaatac
gggcatatcccggtgcgcccggacgggctgccctgcccgtgcggcaacaccggctgcgtg
gagaccgtggcctccggcgcgtcgatcgcccgcgcctacacccgccgcaccggtcgcgag
atcaagggcgcggcagaggttttcgcgctggtcgacaccgaccccgatgccaaggccgtg
ctcgtggacgcggtggacgcgctggccgacggactgatcggcatcgtgcacgcggcctgc
ccggagctgatcatcctcggcggcggcctcgccggtgcgggcgcggccctcaccgacccg
ctgcaccaagccatcgccgaccgcctccgcctggtacccgcaccgcacgtcgtgctcggc
gaatacggcgcccgcgccgggctgatgggtgccgcgttgttcgcccggcaaggttcgctg
gcatga

DBGET integrated database retrieval system