KEGG   Nocardioides sp. JS614: Noca_0137Help
Entry
Noca_0137         CDS       T00443                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
nca  Nocardioides sp. JS614
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Noca_0137
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Noca_0137
Enzymes [BR:nca01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Noca_0137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(151665..152153)
Genome map
AA seq 162 aa AA seqDB search
MSILDAKIARLDGTPSTLGEITGGRPALLVNVASKCGLTPQYAGLEELHERLADRGFTVV
GLPCNQFRGQEPGTADEIAEFCSATYGVTFPMTEKIDVNGPDRHEIYRTLVDTPNESGES
GDITWNFEKFLVDASGAVLARFSPGVEPGDPRLVAAVESQVG
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcctcgacgccaagatcgcccgcctggacgggaccccgagcacgctgggcgag
atcaccggcggccggcccgcgctgttggtcaacgtcgccagcaagtgcgggctgaccccg
cagtacgccgggctcgaggagctccacgagcggctcgcggaccgcggcttcacggtggtc
gggctgccgtgcaaccagttccgcgggcaggagccggggaccgcggacgagatcgccgag
ttctgctccgcgacgtacggcgtcaccttcccgatgaccgagaagatcgacgtcaacggc
ccggaccgccacgagatctaccggaccctcgtcgacaccccgaacgagtccggcgagagc
ggcgacatcacgtggaacttcgagaagttcctcgtcgacgcctccggcgcggtcctcgcc
cggttcagccccggcgtcgagcccggcgacccccgcctggtcgccgccgtcgagtcccag
gtcggctga

DBGET integrated database retrieval system