KEGG   Nocardioides sp. JS614: Noca_0253Help
Entry
Noca_0253         CDS       T00443                                 

Definition
DNA helicase/exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
nca  Nocardioides sp. JS614
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nca00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Noca_0253
Enzymes [BR:nca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Noca_0253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
270200..271954
Genome map
AA seq 584 aa AA seqDB search
MTELFEPVDEHDWRIATGATGLLATFNAAGVLTSSDVHVATRIGVLGGETDERMLLAVAL
TVRAVRRGSVCLDLAGVAATAPDLPWPDEWPVAGSPLVHAGVVRWDHELLYLDRYHRLER
QVHDDLAARLALAPPAVDEQRLEAALARLGGGHFSEEQRAAVVAAVRRRTTILTGGPGTG
KTTTVARLLALLADQAAGRGSRLSIALAAPTGKAATRLQEAVVTELAAVATAWPEAPALV
GRLDGLTLHRLLGWRPDNATRFRHDRANRLKYDVVVVDESSMVELTMMGRLLEALRPDSR
LVLVGDPQQLTSVGAGAVLSDLVAGYEGRPDSPVAALSTNFRSEEDIKSLAAALRSGDAD
EVIAVLRAPSEQVSWVETSDAAEVEAALRPDSLASARAVWAAARDEDAERALAELDRYRL
LCAHREGLYGVRRWNHLVERWLAEDPDVEIYDEWYVGRPLLVTSNDYALDVYNGESGVVV
RQDQRRRVFVAGSERLKEFAPGRLEAVETMHAMTIHKSQGSQADRVSVLLPDEGSRLLTL
ELFYTAITRARHHVRVVGSEAAVRAAVDTRAQRATGLRARLADG
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
gtgactgagctgttcgagcccgtcgacgagcacgactggcggatcgccaccggcgccacc
gggctgctcgccaccttcaacgcggccggggtgctgacctccagcgacgtgcacgtcgcc
acccggatcggtgtcctcggcggcgagaccgacgagcggatgctgctggcggtcgcgctg
accgtgcgggccgtccgccgcggctcggtctgcctcgacctcgccggcgtggccgcgacc
gccccggacctgccctggcccgacgagtggccggtggccggctcgccgctcgtgcacgcc
ggggtggtgcgctgggaccacgagctgctctacctcgaccgctaccaccggctcgagcgg
caggtccacgacgacctggccgcgcgcctcgcgctcgcaccgccggcggtcgacgagcag
cggctcgaagcggcgctggcgaggctcggcggcgggcacttcagcgaggagcagcgggcg
gccgtggtcgcggccgtgcgccggcgtaccaccatcctgaccggcggccccggcaccggg
aagaccacgacggtggcgcgcctgctcgcgctgctcgccgaccaggccgccggacgaggg
agcaggctctcgatcgcgctggcggcgccgaccggcaaggccgcgacccggctgcaggag
gccgtggtcaccgagctcgcggcggtcgcgacggcctggccggaggcgccggccctggtc
ggacgactcgacgggctgaccctgcaccggctcctcggctggcgcccggacaacgcgacc
cggttccgccacgatcgcgccaaccggctcaagtacgacgtggtcgtggtcgacgagtcc
tcgatggtcgagctgacgatgatgggccggttgctggaggccctgcgcccggactcgcga
ctggtgctggtcggcgacccgcagcagctcacctcggtcggcgcgggtgcggtgctgagt
gacctggtggccggctacgagggccggccggactcgccggtcgcggcgttgagcaccaac
ttccgctccgaggaggacatcaagtccctggcagcggcgctgcgctccggcgacgccgac
gaggtgatcgcggtgctgcgcgcgccgtcggagcaggtctcctgggtcgagacctccgac
gcggccgaggtcgaggccgcgctgcgccccgactcgctcgcgtccgcccgcgcggtctgg
gccgcggcgcgcgacgaggacgccgagcgcgcgctggccgagctggaccgctaccggctc
ctgtgcgcgcaccgcgaggggctctacggcgtccgccgttggaaccacctcgtcgagcgc
tggctcgccgaggaccccgacgtggagatctacgacgagtggtacgtcggccgtccgctg
ctggtcaccagcaacgactacgccctcgacgtctacaacggggagagcggggtcgtcgtg
cggcaggaccagcggcggcgagtgttcgtggcggggtcggaacggctcaaggagttcgcg
cccggccgtctcgaggcggtcgagacgatgcacgcgatgacgatccacaagagccagggc
agccaggccgaccgggtgagcgtgctgctccctgacgaggggtcgcggctgctcaccctc
gagctgttctacacggcgatcacccgggcccggcaccacgtgcgcgtggtcgggtcggag
gccgccgtgcgcgccgccgtcgacacccgggcgcagcgggccaccggtctgcgggcgcgt
ctcgcggacggttga

DBGET integrated database retrieval system