KEGG   Nocardioides sp. JS614: Noca_0346Help
Entry
Noca_0346         CDS       T00443                                 

Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nca  Nocardioides sp. JS614
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Noca_0346
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Noca_0346
   00620 Pyruvate metabolism
    Noca_0346
   00640 Propanoate metabolism
    Noca_0346
  Energy metabolism
   00680 Methane metabolism
    Noca_0346
Enzymes [BR:nca01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Noca_0346
Lipid biosynthesis proteins [BR:nca01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Noca_0346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(367344..369338)
Genome map
AA seq 664 aa AA seqDB search
MSDETLSNLLKEERRFEPPAEIAAKANLQADAYDRAAADPQAFWAEQAERLDWDQRWDRV
LDWDDPPFAKWFVGGRLNAAYNCVDRHVAAGRGDKVALHWVGEPLDDTRDITYAELQDEV
CRAANALTDLGVRTGDRVAIYLPMIPEAVVAMLACARIGAPHTVVFGGFSADALASRLED
CQAKVVVTSDGGYRRGSASALKPAVDEARAKTAARGHTVEKVLVVRRTGQDVAWDDAVDL
WWHDAVGGASSEHTPEFFDAEHPLYVMYTSGTTGKPKGILHTTGGYLVGSAYTHWAVFDL
KPDTDVYWCSADIGWVTGHSYLVYGPLANGATQVMYEGTPDSPERGRWWKIIQDYQVSIF
YTAPTAIRSFMKQGREIPDGFDMSSLRILGSVGEPINPEAYIWYRHVIGDDRTPVVDTWW
QTETGAIMISPLPGVTAGKPGSAMTPIPGVSAEVVNDEGDPVPNGSGGYLVLTAPWPAML
RTIWGDDQRYRDTYWSRFAKQGYYFAGDGAKKDDDGDIWVLGRVDDVMNVSGHRLSTTEI
ESALVSHPKVAEAAVVGAKDEDTGQAVCAFVILRESASDPGASDGGDDIVAELRQHVRKE
IGPIATPRQIMIVPELPKTRSGKIMRRLLRDVAEHREVGDVTTLADSSVMDLIAQGLGSG
KSEE
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacgagaccctgtccaacctcctcaaggaggagcgccgtttcgagccgccggcg
gagatcgccgcgaaggcgaacctccaggcggacgcctacgaccgcgccgcggccgacccg
caggcgttctgggccgagcaggccgagcgcctggactgggaccagcggtgggaccgggtg
ctggactgggacgacccgccgttcgccaagtggttcgtgggcgggcggctcaacgcggcg
tacaactgcgtcgaccggcacgtcgcggcgggccgcggcgacaaggtcgcgctgcactgg
gtcggggagcccctcgacgacacgcgtgacatcacctacgccgagctgcaggacgaggtc
tgccgggcggcgaacgcgctgaccgacctgggcgtccgcaccggcgaccgggtcgcgatc
tacctgccgatgatccccgaggccgtggtcgcgatgctcgcctgtgcccggatcggcgcc
ccgcacaccgtggtcttcggcgggttctcggccgacgcgctggcctcgcggctcgaggac
tgccaggccaaggtcgtggtcacctccgacggcggctaccgccgcggctcggcctccgcc
ctcaagccggccgtcgatgaggcccgcgcgaagaccgcggcccgcgggcacacggtcgag
aaggtgctcgtcgtacgccgcaccggccaggacgtcgcctgggacgatgccgtcgacctg
tggtggcacgacgcggtcggcggcgcctcgagcgagcacacgccggagttcttcgacgcc
gagcacccgctctacgtcatgtacacctcgggcaccaccggcaagccgaagggcatcctg
cacacgaccggcggctacctggtcggctcggcgtacacccactgggcggtcttcgacctc
aagcccgacaccgacgtctactggtgctcggccgacatcggctgggtcaccggccactcc
tacctcgtctacgggccgctggccaacggcgccacccaggtgatgtacgagggcacaccg
gacagcccggagcgcggccgctggtggaagatcatccaggactaccaggtcagcatcttc
tacaccgcgcccaccgcgatccgctcgttcatgaagcagggccgcgagatccccgacggc
ttcgacatgtcgtccctgcggatcctcgggtccgtcggcgagccgatcaaccccgaggcg
tacatctggtaccgccacgtgatcggcgacgaccgcaccccggtggtcgacacctggtgg
cagaccgagaccggcgccatcatgatcagcccgctgcccggcgtcaccgccggcaagccc
ggctccgcgatgacgccgatcccgggcgtctcggcggaggtcgtcaacgacgagggcgac
ccggtccccaacggctcgggcggctacctggtgctcaccgcgccctggccggccatgctg
cgcacgatctggggcgacgaccagcgctaccgggacacctactggtcccgcttcgccaag
cagggctactacttcgccggcgacggggccaagaaggacgacgacggcgacatctgggtc
ctcggccgggtcgacgacgtcatgaacgtctcggggcaccgcctctccaccaccgagatc
gagtccgcgctcgtctcccacccgaaggtcgccgaggccgccgtggtcggcgccaaggac
gaggacaccggccaggcggtctgcgcgttcgtgatcctccgcgagtctgcatcggatcct
ggggcgagcgacggtggcgacgacatcgtcgccgagctgcgccagcacgtccgcaaggag
atcgggccgatcgcgacgccgcggcagatcatgatcgtccccgagctgcccaagacccgc
tccggcaagatcatgcggcggctgctgcgcgacgtcgccgagcaccgcgaggtcggcgac
gtcaccacgctcgccgactcctccgtgatggacctgatcgcgcagggcctcggctccggc
aagtccgaggagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system