KEGG   Nocardioides sp. JS614: Noca_0346Help
Entry
Noca_0346         CDS       T00443                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00010  Glycolysis / Gluconeogenesis
nca00620  Pyruvate metabolism
nca00640  Propanoate metabolism
nca00680  Methane metabolism
nca01100  Metabolic pathways
nca01110  Biosynthesis of secondary metabolites
nca01120  Microbial metabolism in diverse environments
nca01130  Biosynthesis of antibiotics
nca01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Noca_0346
   00620 Pyruvate metabolism
    Noca_0346
   00640 Propanoate metabolism
    Noca_0346
  Energy metabolism
   00680 Methane metabolism
    Noca_0346
Enzymes [BR:nca01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Noca_0346
Lipid biosynthesis proteins [BR:nca01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Noca_0346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N Prot_ATP_ID_OB FIST
Motif
Other DBs
NCBI-ProteinID: ABL79890
JGI: Noc0346
UniProt: A1SDK5
Position
complement(367344..369338)
Genome map
AA seq 664 aa AA seqDB search
MSDETLSNLLKEERRFEPPAEIAAKANLQADAYDRAAADPQAFWAEQAERLDWDQRWDRV
LDWDDPPFAKWFVGGRLNAAYNCVDRHVAAGRGDKVALHWVGEPLDDTRDITYAELQDEV
CRAANALTDLGVRTGDRVAIYLPMIPEAVVAMLACARIGAPHTVVFGGFSADALASRLED
CQAKVVVTSDGGYRRGSASALKPAVDEARAKTAARGHTVEKVLVVRRTGQDVAWDDAVDL
WWHDAVGGASSEHTPEFFDAEHPLYVMYTSGTTGKPKGILHTTGGYLVGSAYTHWAVFDL
KPDTDVYWCSADIGWVTGHSYLVYGPLANGATQVMYEGTPDSPERGRWWKIIQDYQVSIF
YTAPTAIRSFMKQGREIPDGFDMSSLRILGSVGEPINPEAYIWYRHVIGDDRTPVVDTWW
QTETGAIMISPLPGVTAGKPGSAMTPIPGVSAEVVNDEGDPVPNGSGGYLVLTAPWPAML
RTIWGDDQRYRDTYWSRFAKQGYYFAGDGAKKDDDGDIWVLGRVDDVMNVSGHRLSTTEI
ESALVSHPKVAEAAVVGAKDEDTGQAVCAFVILRESASDPGASDGGDDIVAELRQHVRKE
IGPIATPRQIMIVPELPKTRSGKIMRRLLRDVAEHREVGDVTTLADSSVMDLIAQGLGSG
KSEE
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacgagaccctgtccaacctcctcaaggaggagcgccgtttcgagccgccggcg
gagatcgccgcgaaggcgaacctccaggcggacgcctacgaccgcgccgcggccgacccg
caggcgttctgggccgagcaggccgagcgcctggactgggaccagcggtgggaccgggtg
ctggactgggacgacccgccgttcgccaagtggttcgtgggcgggcggctcaacgcggcg
tacaactgcgtcgaccggcacgtcgcggcgggccgcggcgacaaggtcgcgctgcactgg
gtcggggagcccctcgacgacacgcgtgacatcacctacgccgagctgcaggacgaggtc
tgccgggcggcgaacgcgctgaccgacctgggcgtccgcaccggcgaccgggtcgcgatc
tacctgccgatgatccccgaggccgtggtcgcgatgctcgcctgtgcccggatcggcgcc
ccgcacaccgtggtcttcggcgggttctcggccgacgcgctggcctcgcggctcgaggac
tgccaggccaaggtcgtggtcacctccgacggcggctaccgccgcggctcggcctccgcc
ctcaagccggccgtcgatgaggcccgcgcgaagaccgcggcccgcgggcacacggtcgag
aaggtgctcgtcgtacgccgcaccggccaggacgtcgcctgggacgatgccgtcgacctg
tggtggcacgacgcggtcggcggcgcctcgagcgagcacacgccggagttcttcgacgcc
gagcacccgctctacgtcatgtacacctcgggcaccaccggcaagccgaagggcatcctg
cacacgaccggcggctacctggtcggctcggcgtacacccactgggcggtcttcgacctc
aagcccgacaccgacgtctactggtgctcggccgacatcggctgggtcaccggccactcc
tacctcgtctacgggccgctggccaacggcgccacccaggtgatgtacgagggcacaccg
gacagcccggagcgcggccgctggtggaagatcatccaggactaccaggtcagcatcttc
tacaccgcgcccaccgcgatccgctcgttcatgaagcagggccgcgagatccccgacggc
ttcgacatgtcgtccctgcggatcctcgggtccgtcggcgagccgatcaaccccgaggcg
tacatctggtaccgccacgtgatcggcgacgaccgcaccccggtggtcgacacctggtgg
cagaccgagaccggcgccatcatgatcagcccgctgcccggcgtcaccgccggcaagccc
ggctccgcgatgacgccgatcccgggcgtctcggcggaggtcgtcaacgacgagggcgac
ccggtccccaacggctcgggcggctacctggtgctcaccgcgccctggccggccatgctg
cgcacgatctggggcgacgaccagcgctaccgggacacctactggtcccgcttcgccaag
cagggctactacttcgccggcgacggggccaagaaggacgacgacggcgacatctgggtc
ctcggccgggtcgacgacgtcatgaacgtctcggggcaccgcctctccaccaccgagatc
gagtccgcgctcgtctcccacccgaaggtcgccgaggccgccgtggtcggcgccaaggac
gaggacaccggccaggcggtctgcgcgttcgtgatcctccgcgagtctgcatcggatcct
ggggcgagcgacggtggcgacgacatcgtcgccgagctgcgccagcacgtccgcaaggag
atcgggccgatcgcgacgccgcggcagatcatgatcgtccccgagctgcccaagacccgc
tccggcaagatcatgcggcggctgctgcgcgacgtcgccgagcaccgcgaggtcggcgac
gtcaccacgctcgccgactcctccgtgatggacctgatcgcgcagggcctcggctccggc
aagtccgaggagtga

DBGET integrated database retrieval system