KEGG   Nocardioides sp. JS614: Noca_0391Help
Entry
Noca_0391         CDS       T00443                                 

Definition
limonene-1,2-epoxide hydrolase
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
nca  Nocardioides sp. JS614
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Noca_0391
Enzymes [BR:nca01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     Noca_0391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(423351..423755)
Genome map
AA seq 134 aa AA seqDB search
MTPEQTVRAFLEHLSRAESEAALALLDADVEWRNTAMPTFRGERVRQMIGDMERRGVGFE
VRWHHVAATGEPDNGTVLTDRTDVLRYSGWETSFRVRGTFTVQDGRITLWDDAFSWLELL
GSGVAGLGKMLTSR
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgacccccgagcagaccgtccgtgccttcctcgagcacctctcccgggcggagagcgag
gcggccctcgcgctcctggacgccgacgtggagtggcgcaacaccgcgatgccgaccttc
cgcggcgagcgcgtgcgccagatgatcggcgacatggagcgccgcggcgtcggcttcgag
gtccgctggcaccacgtcgccgccaccggggaacccgacaacggcacggtgctcaccgac
cgcaccgacgtgctccgctactccggctgggagacgtcgttccgggtccgcggcacgttc
accgtgcaggacggccggatcaccctctgggacgacgcgttcagctggttggagctgttg
ggctccggggtcgccggcctcgggaagatgctgacctcgcgataa

DBGET integrated database retrieval system