KEGG   Nocardioides sp. JS614: Noca_0638Help
Entry
Noca_0638         CDS       T00443                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
nca  Nocardioides sp. JS614
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:nca00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(675751..676617)
Genome map
AA seq 288 aa AA seqDB search
MVRLLGVVNVTPDSFSDGGLYPSVDAAVGAGLQMVDDGAWAVDVGGCSTRPGATPTDAQT
ELERVAPVVRALTRAGARVSIDSMDAGVVDACLSLGATMINDVSGGLYDNRMLDLAARSG
ATLVVSHWRAPSDQMAARAVYSDVAHEVRDELADRVDAALEAGVKASNLIVDPGIGFAKT
ASQNWELLTNLSVLRALGYELMIGTSRKSLFREILGTADLPEDEPGTRDDLTAASTALAA
LLGIDYVRVHNVPANRRAAAVGMRWRGEMPSGGTETRSSVTSELEVGD
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggtccgtctgctaggcgtcgtcaacgtgacgcccgactccttctccgatggcggtctc
taccccagcgttgacgcagctgtaggcgcgggattgcagatggtggatgacggagcgtgg
gcggtcgatgtcggcggatgttcgactcgcccgggcgcgactcctaccgatgctcaaacc
gagctagagcgagtcgctcccgtggtgcgcgcgctgacgcgcgccggtgcacgggtgagc
atcgacagcatggacgccggagtggtcgacgcgtgcttgagcctcggcgccacaatgatc
aacgacgtcagcggcgggctgtatgacaatcgcatgctggaccttgcagcgcggtcgggc
gcgacgctcgtcgtgtcgcactggcgggcgccgagcgaccaaatggctgcgcgagcagtg
tactcggacgtggctcacgaggtgcgagatgagctcgctgatcgcgtcgacgccgccctc
gaagcgggcgtgaaagccagcaacctgatcgtcgatccgggcattggtttcgccaagacc
gcgtcgcagaactgggagctcctgaccaatctctctgttctccgggccctgggctacgag
ctgatgattgggacctctcgaaagagcctcttccgtgaaattctcggcacggccgacctg
cccgaggacgagcccgggactcgtgacgacctgacagccgcgtcgacggcgctcgccgcc
ctcctcggcattgactacgtgagagtccacaacgtccctgctaaccgtcgcgcggccgcc
gtcggcatgcggtggcggggtgagatgccgtcgggcggaacagagactcgttcgtctgtt
acatcggaacttgaggtcggtgattag

DBGET integrated database retrieval system