KEGG   Nocardioides sp. JS614: Noca_0790Help
Entry
Noca_0790         CDS       T00443                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nca  Nocardioides sp. JS614
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Noca_0790
   00052 Galactose metabolism
    Noca_0790
   00500 Starch and sucrose metabolism
    Noca_0790
   00520 Amino sugar and nucleotide sugar metabolism
    Noca_0790
Enzymes [BR:nca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Noca_0790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
833737..835122
Genome map
AA seq 461 aa AA seqDB search
MSMGSAGLNRARDKMAAAGVDEVAIETFAHYYRLLEHGETGMIPESSIDPVDMESLATVA
VSDEDAAAAIRTTAVIKLNGGLGTSMGMDRAKSLLCVRRGLSFLDIIARQVLHLRKEYGA
TLPLIFMNSFRTSEDTMAALARYADLPVEGLPLEFLQNKEPRLLAKDLSPVSWPKDPDLE
WCPPGHGDLYTALRGTGLLERLIEAGYERVFVSNSDNLGAVPDARVAGWFATSGAPFAIE
AVRRTPSDRKGGHFARRKIDGRIVLRETAQTPDADKDALADLDRHKYCSTNNLWFDLAAM
KHALDVRQGILGLPLIRNVKHLDPGDPSTPEVIQIETAMGAAIEVFDGSRLIEVGRERFV
PVKTTNDLLVLRSDVYDLGQDFVLDQAATEVPYVDLDDDYYKLVGEFDKRFPDGAPSMKK
ASSLRIEGDWTFAHGVQVVGDVNLEASSAQRVDADTVLSDG
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatgggaagcgctggcttgaaccgggcacgcgacaagatggcggccgcgggggtc
gacgaggtcgccatcgagaccttcgcgcactactaccggctcctcgagcacggtgagacc
ggcatgatccccgagtcgtcgatcgacccggtcgacatggagtcgctcgccacggtggcg
gtctccgacgaggacgccgcggcggcgatccggacgacggccgtgatcaagctcaacggc
gggctcggcacctcgatgggcatggaccgcgccaagtcgctgctgtgcgtgcgccgcggg
ctgtccttcctcgacatcatcgcccgccaggtgctgcacctgcgcaaggagtacggcgcc
accctcccgctgatcttcatgaacagcttccgcacctcggaggacacgatggcggcgctg
gcgcgctacgccgacctcccggtcgaggggctgccgctggagttcctccagaacaaggag
ccgcggctcctggccaaggacctgtccccggtgagctggcccaaggaccccgacctcgag
tggtgcccgcccggtcatggcgacctctacacggcgctgcgcggcaccggcctgctcgag
cggctgatcgaggcgggctacgagcgggtcttcgtgtcgaactccgacaacctcggcgcg
gtcccggacgcccgggtggcgggctggttcgccacgtccggcgcgccgttcgcgatcgag
gcggtacgccgtaccccctcggaccgcaagggcggccacttcgcccgccgcaagatcgac
ggccggatcgtgctgcgcgagaccgcgcagacccccgacgccgacaaggacgcgctggcc
gacctcgaccgccacaagtactgctcgaccaacaacctgtggttcgacctggccgcgatg
aagcacgcgctcgacgtgcgccagggcatcctcgggctgcccctgatccgcaacgtgaag
cacctcgaccccggcgacccctcgacccccgaggtgatccagatcgagaccgccatgggg
gcggcgatcgaggtcttcgacggatcgcggctgatcgaggtgggccgggagcggttcgtc
cccgtcaagaccaccaacgacctgctggtgctgcgctcggacgtctacgacctcggccag
gacttcgtgctcgaccaggccgccacggaggtgccctacgtcgacctcgacgacgactac
tacaagctggtcggcgagttcgacaagcggttccccgacggcgccccgtcgatgaagaag
gccagctcgctgcggatcgagggcgactggaccttcgcgcacggggtgcaggtcgtgggc
gatgtgaacctggaggcgagctccgcgcagcgcgtcgacgccgacaccgtcctctccgat
ggctga

DBGET integrated database retrieval system