KEGG   Nocardioides sp. JS614: Noca_0952Help
Entry
Noca_0952         CDS       T00443                                 

Definition
putative magnesium chelatase subunit ChlI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
nca  Nocardioides sp. JS614
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Noca_0952
Enzymes [BR:nca01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Noca_0952
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1000098..1001486
Genome map
AA seq 462 aa AA seqDB search
MTSAPSPKTVGELRASGHVQKHLRQEVRDNLLAALREGRDPWPGLHGFEDTVIPQLERAL
IAGHDVVLLGERGQGKTRLLRTLVGLLDEWTPVIEGSELGEHPYDPITHAAQRRAAELGD
DLPVAWRHRDERYSEKLATPDTSVADLIGDVDPMKVAEGRSLGDPETIHFGLIPRSHRGI
VAINELPDLAERIQVAMLNVMEERDIQIRGYVLRLPLDVLVVASANPEDYTNRGRIITPL
KDRFGAEIRTHYPTELDDEVAVIRQEADLVADVPDQLVEILARFTRALRASSAVDQRSGV
SARFAIAGAETVAAAALHRATSQGEDRAVARVVDLETAVDVLGGKIEFESGEEGREAEIL
THLLRTSTAETVRHHFRGLDFALLVAAIENGAMVTTGEQVTARDFLTGLPVLGESELYDE
ICDRFEAGNDGERACAIELALEGLYLARKIGKDTDGAETVYG
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
gtgacctcggctccttccccgaagacggtcggcgagctccgcgcctccggccacgtccag
aagcacctgcgccaggaggtccgcgacaacctgctcgcggcgctgcgcgaggggcgcgac
ccgtggccggggctgcacggtttcgaggacacggtgatcccccagctcgagcgggcgctg
atcgccggccacgacgtggtgctgctcggcgagcgcggccagggcaagacccggctgctg
cgcaccctggtcggcctgctcgacgagtggacgccggtgatcgagggctccgagctcggc
gagcacccctacgacccgatcacccacgccgcgcaacggcgggcggccgagctgggcgac
gacctgccggtcgcgtggcggcaccgcgacgagcgctactccgagaagctcgcgacgccg
gacacctcggtcgcggacctgatcggcgacgtcgacccgatgaaggtcgccgagggtcgc
tcgctgggggacccggagaccatccacttcgggctgatcccccgcagccaccggggcatc
gtcgccatcaacgagctgcccgacctcgccgagcggatccaggtcgcgatgctcaacgtg
atggaggagcgcgacatccagatccgcggctacgtgctgcggctgccactcgacgtgctc
gtcgtcgccagcgcgaaccccgaggactacaccaaccgcggccggatcatcaccccgctc
aaggaccggttcggcgccgagatccgcacccactacccgaccgagctggacgacgaggtg
gccgtgatccggcaggaggccgacctggtcgccgacgtgcccgaccagctcgtcgagatc
ctggcccgcttcacccgggcgctgcgcgcctccagcgccgtcgaccaacgctcgggcgtc
tcggcgcggttcgcgatcgccggggccgagaccgtcgccgccgcggcgttgcatcgcgcc
acctcgcagggcgaggaccgggcggtggcccgggtcgtcgacctcgagaccgcggtcgac
gtgctcggcggcaagatcgagttcgagagcggcgaggagggccgggaggccgagatcctc
actcacctgctccgcacgtccacggccgagaccgtgcgtcaccacttccgcggactcgac
ttcgcgctgctcgtcgccgcgatcgagaacggcgcgatggtcaccaccggtgagcaggtc
accgcccgcgacttcctcaccggcctgcccgtgctcggcgagtccgagctgtacgacgag
atctgcgaccggttcgaggccggcaacgacggcgagcgcgcgtgcgcgatcgagctcgcc
ctggaggggctgtacctcgcccgcaagatcggcaaggacaccgacggagcagagacggtg
tacggctag

DBGET integrated database retrieval system