KEGG   Nocardioides sp. JS614: Noca_1086Help
Entry
Noca_1086         CDS       T00443                                 

Definition
type III restriction enzyme, res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
nca  Nocardioides sp. JS614
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1145470..1147992
Genome map
AA seq 840 aa AA seqDB search
MIEYDESLVEQVAHTLDLRRPNRDALDALAQALAAAETGAELVADLATGVGKTYIAGALL
DYLYASGLSNVVIVTPGSTIQRKTVDNLTPGHRKYLRGLQSNPLVVTLDSLERGEVGAAL
QDTDRFKVFVLTVQSLLRPNTNDARRAYREHETTGVALYDYLQAADDLVVIADEHHVYYS
NNAKKFRQAIEQMHPQALIGLTATPHEAAEPKIVYRYPLSSAIADGYVKIPVLVSRRDGI
SDLRTQLADGLTLLAAKAATMRAYCNMTKQAYAEPILFIVASTIDEANEIRDTLAGSDML
GTAEQVLLVTSEEPDKTLALLDTLEDPDSPIRAVVSVGMLKEGWDVKNVYVIASVRSLES
TLLTEQVLGRGLRLPFGTRTGNPMLDTVEVLSHRSFAALLRQAKVLLEETLGKRTEEATI
TTNPVPGIIAPGVPLGAGDVLPVNPDEAGSISVNLPGVSAAYAEEHDGDGHAQVPGQTHT
GIIFATPESRSDAARASEQAVAHTVGPTPQRSHSLPLFIPRVIRTTRRAPFSLADLDLTQ
VEALGRQFANDEGESLRRTALNAEYDLTGEAHVVITEQRDRVAASAQLIPYGSIETDLVG
RLLRTDGIEASVREANAAQKVAQVFLDGARVTESTPWRVEHGRLATARLTEWIKQRHAAT
RTWIETSVLLDRWPDPQERIEVQPPADRHLVTSSSVFARGYPYSGWERSFYDVVRFDAYS
TEFRLAELFDASSGVESWLRVDEHVPLRIDYSMGAYGRQYEPDFVVIDDERVHWIIEGKR
DSEVTSAVVEAKRDAAREWLRAVNEDSAVSDRWGYLLASESVVANSSSWFALRRGAQTFS
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgaatacgacgagagcctcgtcgagcaggtcgctcacacgctggatctgcgcagg
ccaaaccgggacgccctcgacgcgctggcgcaggcccttgcggccgccgagacaggcgcg
gaactcgtagccgacctcgctacaggggtgggaaagacgtacatcgccggtgccctgctg
gactatctctacgcgtccgggctgagcaacgtcgtgattgtgacgccggggtccacgatt
caacgcaagaccgtggacaacctgacgcccgggcatcgtaaatacctgcgtgggctgcaa
tcgaacccgctggtggtcaccctcgactctcttgaacgtggcgaagtcggtgcggccctc
caagacactgaccgcttcaaagtcttcgtgctcactgttcaatccttgctgcgtccgaat
acgaacgacgctcgacgggcctaccgcgagcacgagacgaccggcgttgccctctacgac
tatcttcaagctgccgacgatctcgtggtgatcgcggatgagcaccacgtctactactcg
aacaacgccaagaagttccggcaggcaatcgagcagatgcacccgcaggcactgattggc
ctcactgctaccccgcacgaggccgccgagccgaagatcgtttatcgctatccgctctcg
tcagcgatcgctgacggctacgtgaagattccagttctcgtctcccggcgcgacggcatc
tccgacctgcgcacacagctcgccgacggcctcaccctccttgccgcgaaggccgcaaca
atgcgcgcctactgcaacatgaccaagcaggcgtacgcggaaccgatcctcttcatcgtc
gcgtccacgattgacgaggccaacgagattcgcgacaccctcgcggggtcggacatgctc
ggcacagctgagcaggtgctgttggtgacgagcgaggaaccggacaagacactcgcgctg
ctcgacacgctagaggaccccgattctccaatccgtgccgtggtcagcgtggggatgctg
aaagagggctgggacgtcaagaacgtctacgtcatcgcgtctgtgcggtcgctggaatca
acgctgctcacggagcaggttctcggtcgcgggttgcgactccccttcggcacccgcacg
ggcaacccaatgcttgacaccgtggaggtgctgtcgcaccgctcgttcgcggccctgttg
cggcaggcgaaggtgttgcttgaagagacactcggcaaacgcaccgaggaagcgacaatc
acaaccaacccagtcccggggattatcgcccccggagttccgctaggagcgggtgatgtc
ctcccggtgaaccccgacgaggccggaagcatctcggtaaacctccccggcgtttcggcc
gcgtacgccgaggaacacgacggtgacggtcacgctcaggtgccgggccagactcacaca
ggaatcatcttcgccacgccggaaagccgttcagatgccgcaagggcgtctgagcaggct
gtcgcccacaccgtcgggccgacgccgcagcgcagccactcgctacccctgttcatccct
cgcgtgatccgcacgacgaggcgcgcgccgttctcactcgccgacctggacctgacgcag
gtcgaggcgttgggtcggcagttcgccaatgacgagggcgagtccctgcgccggacggca
ctcaatgctgaatacgacctaaccggtgaagcgcacgttgtcataaccgagcagcgcgac
cgagtggcggcgtcagcgcagctaatcccgtacggctcgatcgagaccgacctcgtaggc
cgcctgttgcgcaccgatgggatcgaggcgtcggtgcgcgaagcgaacgccgcccagaag
gtcgcgcaggtgttcctagacggtgctcgcgtcaccgagagcaccccgtggcgggttgag
cacggtcggctcgcgacagctcgcctgacggaatggatcaagcagcggcatgctgccacc
cggacgtggatcgagacctcggtgctgctcgaccgctggcctgatccgcaggagcgcatc
gaggtacagccgcctgccgaccggcacctcgtcacctcttcgtccgtgtttgcgcggggc
tacccgtactcggggtgggagcggtccttctacgacgtggtgcgcttcgacgcctactcg
acagagtttcggttggctgagctgttcgacgcctcaagcggtgtcgagtcttggttgcga
gttgacgagcacgtaccgctacgcatcgactactcgatgggcgcctatgggcggcagtac
gaacccgacttcgtggtgatcgacgacgagcgtgtccactggatcatcgaaggtaagcgc
gacagtgaggtgacgtccgcagtggtggaagccaagcgcgacgccgcccgggagtggctg
cgcgccgtcaacgaggactcggcggtctcagaccgatggggttacctccttgcgtccgag
tctgtcgttgccaactcgtcatcgtggttcgccctacggaggggcgctcagaccttctcg
tga

DBGET integrated database retrieval system