KEGG   Nocardioides sp. JS614: Noca_1301Help
Entry
Noca_1301         CDS       T00443                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
nca  Nocardioides sp. JS614
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Noca_1301
Enzymes [BR:nca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Noca_1301
    3.5.1.-  
     Noca_1301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1375042..1375626)
Genome map
AA seq 194 aa AA seqDB search
MSESKRALVVTDVQNDFCEGGSLPVAGGARVAADIAEVLHLWSVQGPGAPDYAHVVATKD
HHIDPGEHWSREPDYLDSWPVHCRVGTDGASFHPNLDPQPFDAIFFKGEHQAAYSGFEGR
TVEGVGLAEWLRSRGVTEVDVCGIATDYCVRKTALDAVREGFTTRLLADLCAGVAPDTSA
AALEEMRAAGVSVA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagtcgaagcgtgccctcgtcgtgaccgacgtgcagaacgacttctgcgaaggc
ggctcactgccggtggcgggcggggcgcgggtggcggcagacatcgccgaggtcctgcac
ctgtggagcgtgcaggggcccggggcgcccgactacgcgcacgtagtggccaccaaggac
caccacatagatccgggcgagcactggtcccgcgagccggactacctcgactcctggccg
gtgcactgccgggtggggaccgacggcgcctccttccacccgaacctcgacccccagccg
ttcgacgccatcttcttcaagggcgagcaccaggcggcgtactccgggttcgagggccgc
accgtcgagggggtggggctggccgagtggctgcggtcgcgcggcgtgaccgaggtggac
gtgtgcggcatcgcgaccgactactgcgtgcgcaagaccgccctggacgccgtgcgggag
ggcttcacgacgcggctcctcgccgacctgtgcgcgggcgtggccccggacacctcggcc
gcggcgctcgaggagatgcgggccgccggggtgagcgttgcctga

DBGET integrated database retrieval system