KEGG   Nocardioides sp. JS614: Noca_1745Help
Entry
Noca_1745         CDS       T00443                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00260  Glycine, serine and threonine metabolism
nca00750  Vitamin B6 metabolism
nca01100  Metabolic pathways
nca01110  Biosynthesis of secondary metabolites
nca01120  Microbial metabolism in diverse environments
nca01230  Biosynthesis of amino acids
Module
nca_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Noca_1745
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Noca_1745
Enzymes [BR:nca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Noca_1745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C
Motif
Other DBs
NCBI-ProteinID: ABL81258
JGI: Noc1745
UniProt: A1SHH3
Position
1855343..1856440
Genome map
AA seq 365 aa AA seqDB search
MNPTGFTPTHQWRGVIEEYRQLLQIPEDTVAVTLREGGTPLVFSEWLSGRTGADVWLKVE
GGNPTGSFKDRGMTAAISVAKHEGAEAVVCASTGNTSASMAAYAAKAGLKPLVLVPEGKI
AAGKMAQAILHGAQVIMVRGNFDDCLGLAKGLAWDYPVALVNSVNPVRLEGQKTAAFEIV
DFLGDAPDFHLLPVGNAGNISAYWLGYTQYADWGRATKRPVMRGFQAEGAAPLVTGEPFP
DPETRATAIRIGNPASWKLAAAARDESGGRFAAVSDGQILAAQRELASRDGVFVEPASAA
GIAGLLEELAAGEDYRGSTVVVTVTGHGLKDTATALEGFTESGNSIVDTVIDAEVTAAAQ
AAGLA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgaatccgaccggcttcacgcccacccaccagtggcgcggtgtgatcgaggagtaccgg
cagctgctgcagatccccgaggacacggtggcggtgacgctgcgcgagggcggcacgccg
ctggtcttctcggagtggctctccggccggaccggcgccgacgtctggctcaaggtcgag
ggcggcaacccgaccgggtccttcaaggaccgcgggatgaccgccgcgatctcggtcgcg
aagcacgagggcgccgaggcggtcgtctgtgcctcgaccggcaacacgtccgcctcgatg
gcggcctacgccgcgaaggccgggctgaagcccctcgtgctggtgcccgagggcaagatc
gccgcggggaagatggcccaggcgatcctgcacggcgcccaggtgatcatggtgcgcggc
aacttcgacgactgcctcgggctggccaagggcctcgcatgggactaccccgtcgcgctg
gtgaactcggtcaacccggtgcggctcgagggccagaagaccgcggcgttcgagatcgtc
gacttcctcggcgacgccccggacttccacctgctacccgtcggcaacgccggcaacatc
tcggcgtactggctcggctacacccagtacgccgactggggccgggccaccaagagaccc
gtgatgcgcggcttccaggccgagggggcggcacccctggtcaccggtgagccgttcccg
gaccccgagacccgcgcgaccgcgatccggatcggcaaccccgcatcgtggaagctcgcc
gcggcggcgcgcgacgagtccggcggccggttcgctgcggtgagcgacggccagatcctg
gccgcccagcgcgagctggcctcccgggacggcgtcttcgtcgagcccgcgtcggccgcc
ggcatcgcgggcctgctcgaggagctcgcggccggcgaggactaccgcggcagcacggtc
gtcgtgacggtgaccgggcacggtctcaaggacacggcgaccgcgctcgagggcttcacc
gagagcgggaacagcatcgtcgacaccgtgatcgacgccgaggtgaccgccgcggcgcag
gccgccggtctcgcgtaa

DBGET integrated database retrieval system