KEGG   Nocardioides sp. JS614: Noca_1780Help
Entry
Noca_1780         CDS       T00443                                 

Definition
D-amino-acid oxidase (EC:1.4.3.3)
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
nca  Nocardioides sp. JS614
Pathway
Glycine, serine and threonine metabolism
Penicillin and cephalosporin biosynthesis
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Noca_1780
   00330 Arginine and proline metabolism
    Noca_1780
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Noca_1780
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    Noca_1780
Enzymes [BR:nca01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     Noca_1780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1890652..1891584
Genome map
AA seq 310 aa AA seqDB search
MTDRVIVVGAGVIGLTCAVRLLQAGHRVDVVARDLPLETTSAVAGAFWYPYRALPQDRVA
AWSATSYAVFDALADTDPESGVRMVAGTEVFMAPEPDPWWGAAVPGLTRTRDVPPGWVDG
WTFTTPVVDTGVYLAWLAGRVEQLGGTITRLNLSALPSGPGLVVNCAGLGARLLGADRTV
VPVRGQVVVVEQTGIDRWWLDRSGPTYVVPREHDVVVGGTDVEGEWSRTPSPATAEAILE
RATRLVPGLRGARVLRHRVGLRPVRPAVRLDRVGDVVHCYGHGGAGVTLSWGAADEVVAL
AAVSAAAPGG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgacggaccgggtgatcgtggtcggggcgggcgtcatcggcctgacctgtgcggtgcgg
ctgctccaagccgggcaccgcgtcgacgtggtcgcccgggacctcccgctggagacgacc
tccgctgtcgccggggcgttctggtatccgtaccgcgcccttccacaggaccgggtcgcg
gcctggtcggccacgtcgtatgccgtcttcgacgccctcgccgacaccgacccggagtcc
ggggtgcggatggtggcgggcaccgaggtgttcatggcgcccgagcccgacccctggtgg
ggtgcggcggtgccgggcctgacccgcacccgcgacgtcccgcccggatgggtcgacggc
tggacgttcaccacgccggtggtcgacaccggcgtctacctcgcctggctggccggtcgc
gtggagcagctgggcgggacgatcacccggctcaacctctccgccctgccctccggcccc
gggctggtcgtcaactgcgccgggctcggcgcccgcctcctcggcgcggaccggaccgtg
gtccccgtgcgcgggcaggtggtcgtggtcgagcagaccggcatcgaccgctggtggctg
gaccgctcgggaccgacgtacgtcgtcccccgggagcacgacgtcgtcgtcggcggcacc
gacgtcgagggcgagtggagccggacgccgtccccggcgaccgccgaggcgatcctcgag
cgcgccacccggttggtgcccgggctccgtggcgcgcgggtgctgcggcaccgggtcggc
ctgcgtccggtgcgcccggccgtgcggctggaccgggtcggggacgtggtccactgctac
gggcacggcggcgccggggtcaccctgagctggggtgcggccgacgaggtggtcgcgctg
gccgcggtcagcgcggcggctccaggcgggtga

DBGET integrated database retrieval system