KEGG   Nocardioides sp. JS614: Noca_2303Help
Entry
Noca_2303         CDS       T00443                                 

Definition
2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nca  Nocardioides sp. JS614
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Noca_2303
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Noca_2303
  Amino acid metabolism
   00310 Lysine degradation
    Noca_2303
Enzymes [BR:nca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Noca_2303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2452196..2453989)
Genome map
AA seq 597 aa AA seqDB search
MATEVNLPALGESVTEGTVTRWLKQVGDSVAVDEPLLEVSTDKVDTEIPSPIAGTLLEIR
ANEDDTVEVGAVLAVIGDAGESSGDSGGAQAEAQPDPEPEPEAQPEPEPAQEQAQQEAQQ
PAAEQPAPAAEAKPSGGSGTAVTLPALGESVTEGTVTRWLKSVGDEVAVDEPLLEVSTDK
VDTEIPSPVAGTLLEIKVAEDETVEVGAELAVIGSGQAAPAESKPEPTPEPEPEPTPEPE
PEPEAAPEPEPAPAPQEQAAPPAPAPAAAAQPTAQPAAQPVASGDGPGYVTPLVRKMAAQ
HGVDLASVTGTGVGGRIRKQDVLDAAKAQQQAQQQAQQPAQAAPAAPAAPSAPVSSGAPS
PLRGTTVKMSRLRKIIATRMVDSLQTSAQLTQVVEVDVTNIARLRDEAKADFLSREGVKL
SYLPFFAKAAIDALKHHPALNATIDTEAGEVTYYDRENLAIAVDTEKGLITPVIKDAGDL
SIAGLAKKIADVAQRTRTNKIGPDELSGGTFTITNLGSVGALWDTPIVNKPQVAILGPGA
VVKRPVVIDDPNLGETIAVRYMVYLALTYDHQLVDGADAGRFLTDVKQRLESGQFEV
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
ttggccaccgaagtcaacctgccggcactcggcgagtccgtcaccgaaggcaccgtcacc
cgctggctcaagcaggtgggcgactcggtggccgtcgacgagccgctgctcgaggtctcc
acggacaaggtcgacaccgagatcccctcccccatcgccggcacgctgctggagatccgg
gccaacgaggacgacaccgtcgaggtcggtgccgtgctggcggtgatcggggacgccggt
gagtcttcgggtgactccggcggcgcccaggccgaggcccagcccgaccccgagccggag
cccgaggcacagcccgagccggagcccgcccaggagcaggcgcagcaggaggcgcagcag
cccgctgccgagcagccggccccggcggccgaggccaagccgtccggtggctccgggacg
gccgtgaccctcccggccctcggcgagtcggtcaccgagggcaccgtcacccgctggctg
aagtcggtcggcgacgaggtcgccgtggacgagccgctgctcgaggtctccaccgacaag
gtcgacaccgagatcccctcgccggtcgccggcaccctgctcgagatcaaggtcgccgag
gacgagaccgtcgaggtcggggccgagctcgccgtgatcgggtccggacaggccgcgccg
gccgagtcgaagcccgagccgacccccgagcccgagccggagccgacccccgagcccgag
cccgagcccgaggcggcacccgagcccgagccggcacccgcgccccaggagcaggccgcc
ccgccggctcccgcgccggccgccgccgcccagcccactgcgcagcccgccgcccagccc
gtcgcgagcggtgacggcccgggctacgtgacgccgctggtgcgcaagatggccgcccag
cacggcgtggacctcgcgagcgtcaccggcaccggcgtgggggggaggatccgcaagcag
gacgtgctcgacgccgccaaggcccagcaacaggcccagcaacaggcccagcagcccgcc
caggcggctccggccgccccggctgccccctcggcaccggtctcctcgggcgcgccgtcg
ccgctgcgcggcaccacggtgaagatgtcgcggctgcgcaagatcatcgccacgcgcatg
gtcgactcgctgcagacctccgcccagctgacccaggtggtcgaggtcgacgtcaccaac
atcgcgcggctgcgcgacgaggcgaaggcggacttcctgtcccgggagggcgtcaagctg
tcgtacctgccgttcttcgcgaaggccgcgatcgacgcgctcaagcaccacccggcgctg
aacgcgaccatcgacaccgaggcgggcgaggtcacctactacgaccgcgagaacctcgcg
atcgcggtggacaccgagaagggtctgatcaccccggtgatcaaggacgcgggcgacctc
tccatcgccggcctggcgaagaagatcgccgacgtcgcccagcgcacgcgcaccaacaag
atcggcccggacgagctctcgggcgggacgttcacgatcaccaacctgggcagcgtcggg
gccctgtgggacaccccgatcgtgaacaagccgcaggtcgcgatcctcgggcccggcgcc
gtcgtcaagcggcccgtggtcatcgacgacccgaacctcggcgagacgatcgcggtgcgc
tacatggtctacctggcactcacctacgaccaccagctggtcgacggcgccgacgcaggc
cgtttcctcaccgacgtgaagcagcgcctggagtcgggccagttcgaggtctga

DBGET integrated database retrieval system