KEGG   Nocardioides sp. JS614: Noca_2359Help
Entry
Noca_2359         CDS       T00443                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00010  Glycolysis / Gluconeogenesis
nca00020  Citrate cycle (TCA cycle)
nca00620  Pyruvate metabolism
nca00640  Propanoate metabolism
nca00650  Butanoate metabolism
nca00680  Methane metabolism
nca01100  Metabolic pathways
nca01120  Microbial metabolism in diverse environments
nca01130  Biosynthesis of antibiotics
nca01200  Carbon metabolism
Module
nca_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Noca_2359
   00020 Citrate cycle (TCA cycle)
    Noca_2359
   00620 Pyruvate metabolism
    Noca_2359
   00640 Propanoate metabolism
    Noca_2359
   00650 Butanoate metabolism
    Noca_2359
  Energy metabolism
   00680 Methane metabolism
    Noca_2359
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Noca_2359
Enzymes [BR:nca01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Noca_2359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ABL81864
JGI: Noc2359
UniProt: A1SJ79
Position
complement(2515219..2516223)
Genome map
AA seq 334 aa AA seqDB search
MTDLKLYQVGTFAAGNRLVDLELRSVQAHPDRTNSITSGHRACQGCGEALGARYVLDAAM
RAAGGDLVVANATGCLEVFSTPYPESSWQVAWLHSLFGNAPAVAAGMAAGLRALGRETRV
VGQGGDGGTVDIGFGCLSGMFERNDDVLYVCYDNQGYMNTGVQRSGATPPAARTANTAPV
GPEPGNAFGQGKSAPLIAMAHEIPYVATATVADLRDLERKVEKAMSIRGARYLHVLVPCP
LGWAAAPSDTIRLARLATESGIFPVFEAEHGEVTDVSPIRRQVPVEEYLKLQGRYAHLFG
KHARPDLVARLQAGADRNIARFGLLEAEPRTGSD
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgacggatctcaagctctaccaggtcggcaccttcgcggccggcaaccggctcgtcgac
ctcgagctccgctccgtgcaggcgcaccccgaccggacgaactcgatcacctccggccac
cgggcctgccagggctgcggcgaggcgctcggcgcacgctacgtcctcgacgcggcgatg
cgggcggccgggggcgacctggtggtcgccaatgccaccggctgcctggaggtcttctcc
accccgtacccggagtcctcctggcaggtcgcctggctgcactcgctgttcggcaacgcc
cccgcggtcgcggccggcatggccgccggcctgcgggccctcggccgcgagacccgggtc
gtcggacagggtggggacggcggcacggtggacatcgggttcggctgcctctcgggcatg
ttcgagcgcaacgacgacgtgctgtacgtctgctacgacaaccagggctacatgaacacc
ggcgtgcagcgctcgggtgccacgcctccggcagcacggacggcgaacacggctccggtc
gggcccgagccgggcaacgcgttcggccagggcaagtcggcgccgttgatcgcgatggcg
cacgagatcccgtacgtcgccaccgcgaccgtcgccgacctgcgcgacctcgagcgcaag
gtcgagaaggcgatgtcgatccgcggcgcccgctacctccacgtgctggtcccctgcccg
ctggggtgggccgcggcccccagcgacacgatccgcctggctcggctcgcgaccgagtcc
gggatcttcccggtcttcgaggccgagcacggcgaggtcaccgacgtgtctccgatccgc
cgccaggtccccgtcgaggagtatctgaagctgcagggccgctacgcgcacctcttcggc
aagcacgcccgtcccgatctcgtcgcgcggctccaggccggcgccgaccgcaacatcgcc
cgcttcggcctcctcgaggccgagccccgaaccgggagcgactga

DBGET integrated database retrieval system