KEGG   Nocardioides sp. JS614: Noca_2363Help
Entry
Noca_2363         CDS       T00443                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nca  Nocardioides sp. JS614
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Noca_2363
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Noca_2363
  Lipid metabolism
   00071 Fatty acid degradation
    Noca_2363
  Amino acid metabolism
   00350 Tyrosine metabolism
    Noca_2363
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Noca_2363
   00626 Naphthalene degradation
    Noca_2363
Enzymes [BR:nca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Noca_2363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2518792..2519856)
Genome map
AA seq 354 aa AA seqDB search
MQALRLRAWKSDPVLEDVAVPEPGPDEVLVQVGGAGACHSDLHLMHEFEPGTLPWSPPFT
LGHENAGWVHTVGTGVTGLEPGQPVAVVGAWGCGVCDRCRAGVETYCERPDLAPVPSGGG
GLGLDGGMAEYLLVRGARHVVPLPEGLDPVTAAPLTDAGLTPYHAVRRSLAKLAPGATAL
VIGVGGLGHLGVQVLRAVTAARVIAVDPRSSALSLASKVGADATLTPGPATAAEVRELTH
GVGADVVLDFVGSDDTLALAAQAVRQLGDLTVVGIAGGSLPFSFFGVPYECSVQTTYWGN
RTELVEVLDLAARGLLTAHTTTFELAQAPEVYAELARGEIDGRAVVVPNRAYRP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggctctcaggttgcgcgcatggaagtccgacccggtgctcgaggacgtcgccgtc
cccgaaccgggccccgacgaggtcctggtccaggtgggaggtgcgggcgcctgccactcc
gacctgcacctgatgcacgagttcgagcccgggacgctgccctggtccccgccgttcacg
ctcggccacgagaacgccggctgggtgcacaccgtcggcaccggggtcaccgggctcgag
cccggccagccggtcgccgtggtcggggcctggggctgcggcgtctgcgaccgctgccgc
gcaggtgtcgagacctactgcgagcgccccgacctggcacccgtgccgtccggcggcggg
ggtctcggcctggacggcgggatggcggagtacctcctggtgcgcggcgcgcgacacgtc
gttccgctgcctgagggcctcgacccggtgaccgccgctccactgaccgacgcaggcctc
acgccctaccacgccgtgcgacgctcgctcgcgaagctggcgcccggcgccaccgcgctg
gtcatcggcgtcggcgggctcggccacctcggcgtccaggtgctccgtgctgtcacggcc
gcccgggtgatcgctgtcgacccgcgctcctccgcgctgagcctggcctcgaaggtgggt
gccgacgccacgctcacccccggacccgccacggcggcggaggtccgtgagctcacccac
ggggtcggcgcggacgtcgtgctggacttcgtcggctcggacgacacgctggccctggcc
gcccaggcggtccgccagctcggggacctcaccgtcgtcggcatcgccggcggcagcctg
ccgttctccttcttcggcgtcccctacgagtgcagcgtgcagacgacgtactggggcaac
cggaccgagctggtcgaggttctcgacctcgcggcgcggggcctgctcaccgcacacacc
acgaccttcgagctcgcgcaggcacccgaggtctacgccgagctggcccgcggcgagatc
gacgggcgggcggtggtggtgcccaaccgggcctaccggccctga

  All links  
No link information was found.   
DBGET integrated database retrieval system