KEGG   Nocardioides sp. JS614: Noca_2454Help
Entry
Noca_2454         CDS       T00443                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
nca  Nocardioides sp. JS614
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:nca00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:nca00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2614573..2615496)
Genome map
AA seq 307 aa AA seqDB search
MLPPSGDQYEISAGGYRAVVTECGAGLRLLEHAGVPLVDGFAADQVAPGGRGQLLAPWPN
RIGDGAYSFGGGDHQLPLSEPARHNASHGLVRWAGWSVSEHTAHSVTLTYRLMAQSGYPW
TLDLRVGYALSDHGLSVTQTARNHAATEAPYASGAHPYLAVGPGPVDGWELTLPAAARVL
VDDRLLPIGQEDVTDTAYDFRVARPIHEVGFDDAFTDLTRDGDGRATVVLADQRSGRGVA
LWVDERHGWLQLFSADDVPGTARRSLAVEPMTAPADAFRSGTGLVTLAPAGQPGDVFAAT
WGIRAFA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgctccctcccagcggcgaccagtacgagatctcggcgggcggctaccgggcggtcgtg
acggagtgcggtgccgggctgcggctgctcgagcacgcgggcgtcccgctggtcgacggc
ttcgctgcggaccaggtcgcccccggcgggcgcgggcagctgctggcaccgtggccgaac
cggatcggggacggcgcctactccttcggcggtggcgaccaccagctcccgctcagcgag
ccggcccggcacaacgcctcgcacgggctggtccgctgggccggctggtcggtgtcggag
cacaccgcccactcggtgacgctgacctaccggctgatggcccagagcggctacccgtgg
accctcgacctgcgggtcgggtacgccctctccgaccacgggctgagcgtcacccagacc
gcccgcaaccacgcggcgacggaagcgccgtacgcgagcggcgcgcacccctatctcgcc
gtcggaccggggccggtggacggctgggagctcaccctgccggcagcagcccgcgtgctc
gtcgacgaccgcctgctgcccatcggacaggaggacgtcacggacacggcgtacgacttc
cgcgtcgcccggccgatccacgaggtcgggttcgacgacgccttcaccgacctgaccagg
gacggcgacggccgagccaccgtggtcctggccgatcagcggagcggccggggcgtggcg
ctctgggtcgacgagcggcacgggtggctgcaactgttcagcgccgacgacgtgccgggg
accgcgcgtcgctcgttggcggtcgagccgatgaccgcgccggcggacgcgttccggagc
ggcaccggcctcgtgaccctggccccggccgggcagccgggtgacgtcttcgccgccacc
tgggggatccgggcgttcgcctag

DBGET integrated database retrieval system