KEGG   Nocardioides sp. JS614: Noca_2532Help
Entry
Noca_2532         CDS       T00443                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nca  Nocardioides sp. JS614
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Noca_2532
   01230 Biosynthesis of amino acids
    Noca_2532
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Noca_2532
   00051 Fructose and mannose metabolism
    Noca_2532
   00562 Inositol phosphate metabolism
    Noca_2532
Enzymes [BR:nca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Noca_2532
Exosome [BR:nca04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Noca_2532
  Exosomal proteins of bladder cancer cells
   Noca_2532
  Exosomal proteins of melanoma cells
   Noca_2532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2701382..2702176
Genome map
AA seq 264 aa AA seqDB search
MATSRTPLMAGNWKMNLNHQEAVVLVQKLAWTLADKKHDYARAEVVVVPPFTDLRSVQTL
VDGDRLLVKYGAQDVSTHDGGAFTGEISAGMLAKLGCSYVVVGHSERREYHTEDDQEVNA
KAHQALGAGMVPIVCVGEGLDVRQAGGQVAHCLAQVDGSLAGFTAEQIAGLVIAYEPIWA
IGTGEVATPDDAQEVCAAIRERIREVHGDEAADGVRVLYGGSVKAANVAGIMAKDDVDGC
LVGGASLQADEFGGICRFYDMPVI
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgagtcgcaccccgctgatggcgggcaactggaagatgaacctcaaccaccaa
gaggcggtggtgctggtccagaagctcgcgtggacgctcgctgacaagaagcacgactat
gcgcgtgccgaggtcgtcgtcgtcccgccgttcaccgacctgcgctccgtgcagaccctg
gtggacggcgaccggctgctcgtgaagtacggcgcccaggacgtctcgacacacgacggc
ggcgccttcacgggcgagatctcggccggcatgctcgccaagctcggctgctcctacgtc
gtggtggggcacagcgagcgccgcgagtaccacaccgaggacgaccaggaggtcaacgcc
aaggcgcaccaggccctgggcgcgggcatggtcccgatcgtgtgcgtgggcgaaggtctc
gacgtgcgccaggccgggggacaggtggcccactgcctggcccaggtcgacggctcgctc
gccgggttcaccgccgaacagatcgccggcctcgtgatcgcctacgagccgatctgggcg
atcggcaccggcgaggtcgcgaccccggacgacgcccaggaggtctgcgcggcgatccgc
gagcggatccgcgaggtgcacggcgacgaggccgcggacggcgtgcgcgtcctctacggc
ggctcggtcaaggccgcgaacgtggccggcatcatggccaaggacgacgtcgacggctgt
ctggtcggtggcgccagcctccaggcggacgagttcggcggcatctgccggttctacgac
atgccggtcatctga

DBGET integrated database retrieval system