KEGG   Nocardioides sp. JS614: Noca_2532Help
Entry
Noca_2532         CDS       T00443                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00010  Glycolysis / Gluconeogenesis
nca00051  Fructose and mannose metabolism
nca00562  Inositol phosphate metabolism
nca01100  Metabolic pathways
nca01110  Biosynthesis of secondary metabolites
nca01120  Microbial metabolism in diverse environments
nca01130  Biosynthesis of antibiotics
nca01200  Carbon metabolism
nca01230  Biosynthesis of amino acids
Module
nca_M00002  Glycolysis, core module involving three-carbon compounds
nca_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Noca_2532
   00051 Fructose and mannose metabolism
    Noca_2532
   00562 Inositol phosphate metabolism
    Noca_2532
Enzymes [BR:nca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Noca_2532
Exosome [BR:nca04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Noca_2532
  Exosomal proteins of bladder cancer cells
   Noca_2532
  Exosomal proteins of melanoma cells
   Noca_2532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABL82036
JGI: Noc2532
UniProt: A1SJQ1
Position
2701382..2702176
Genome map
AA seq 264 aa AA seqDB search
MATSRTPLMAGNWKMNLNHQEAVVLVQKLAWTLADKKHDYARAEVVVVPPFTDLRSVQTL
VDGDRLLVKYGAQDVSTHDGGAFTGEISAGMLAKLGCSYVVVGHSERREYHTEDDQEVNA
KAHQALGAGMVPIVCVGEGLDVRQAGGQVAHCLAQVDGSLAGFTAEQIAGLVIAYEPIWA
IGTGEVATPDDAQEVCAAIRERIREVHGDEAADGVRVLYGGSVKAANVAGIMAKDDVDGC
LVGGASLQADEFGGICRFYDMPVI
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgagtcgcaccccgctgatggcgggcaactggaagatgaacctcaaccaccaa
gaggcggtggtgctggtccagaagctcgcgtggacgctcgctgacaagaagcacgactat
gcgcgtgccgaggtcgtcgtcgtcccgccgttcaccgacctgcgctccgtgcagaccctg
gtggacggcgaccggctgctcgtgaagtacggcgcccaggacgtctcgacacacgacggc
ggcgccttcacgggcgagatctcggccggcatgctcgccaagctcggctgctcctacgtc
gtggtggggcacagcgagcgccgcgagtaccacaccgaggacgaccaggaggtcaacgcc
aaggcgcaccaggccctgggcgcgggcatggtcccgatcgtgtgcgtgggcgaaggtctc
gacgtgcgccaggccgggggacaggtggcccactgcctggcccaggtcgacggctcgctc
gccgggttcaccgccgaacagatcgccggcctcgtgatcgcctacgagccgatctgggcg
atcggcaccggcgaggtcgcgaccccggacgacgcccaggaggtctgcgcggcgatccgc
gagcggatccgcgaggtgcacggcgacgaggccgcggacggcgtgcgcgtcctctacggc
ggctcggtcaaggccgcgaacgtggccggcatcatggccaaggacgacgtcgacggctgt
ctggtcggtggcgccagcctccaggcggacgagttcggcggcatctgccggttctacgac
atgccggtcatctga

DBGET integrated database retrieval system