KEGG   Nocardioides sp. JS614: Noca_2743Help
Entry
Noca_2743         CDS       T00443                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00071  Fatty acid degradation
nca00280  Valine, leucine and isoleucine degradation
nca00281  Geraniol degradation
nca00310  Lysine degradation
nca00360  Phenylalanine metabolism
nca00362  Benzoate degradation
nca00380  Tryptophan metabolism
nca00410  beta-Alanine metabolism
nca00627  Aminobenzoate degradation
nca00640  Propanoate metabolism
nca00650  Butanoate metabolism
nca00903  Limonene and pinene degradation
nca00930  Caprolactam degradation
nca01100  Metabolic pathways
nca01110  Biosynthesis of secondary metabolites
nca01120  Microbial metabolism in diverse environments
nca01130  Biosynthesis of antibiotics
nca01212  Fatty acid metabolism
Module
nca_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Noca_2743
   00650 Butanoate metabolism
    Noca_2743
  Lipid metabolism
   00071 Fatty acid degradation
    Noca_2743
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Noca_2743
   00310 Lysine degradation
    Noca_2743
   00360 Phenylalanine metabolism
    Noca_2743
   00380 Tryptophan metabolism
    Noca_2743
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Noca_2743
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Noca_2743
   00281 Geraniol degradation
    Noca_2743
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Noca_2743
   00627 Aminobenzoate degradation
    Noca_2743
   00930 Caprolactam degradation
    Noca_2743
Enzymes [BR:nca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Noca_2743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABL82246
JGI: Noc2743
UniProt: A1SKB1
Position
2915976..2916755
Genome map
AA seq 259 aa AA seqDB search
MAITSDLRDDGIRVVTMDAPPVNALTVQGWYDVAAALDAAAGDLDTKVVVLRAEGRGFNA
GVDIKEMQHTGGFEALIGANRGCFAAFKAVYECAVPVVAAVHGFCLGGGVGLVGNADCVI
ASDDAYFGVPEVDQGALGAATHLARLVPQHLMRTLYFTARTIPATALVQFGSVLETVPRD
QLDDAALKVAGEIAAKDTRVIRAAKEALNGIDPVDVNRSYRFEQGFTFELNLAGVSDELR
DAFAGTDKGSRRARSTEAR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcacttcggacctccgcgacgacggcatccgggtggtgacgatggacgcgccc
ccggtcaacgcgctgaccgtgcagggttggtacgacgtcgccgccgccctggacgcggcg
gccggcgacctcgacaccaaggtcgtcgtgctccgtgcggagggccgcggcttcaacgcc
ggcgtcgacatcaaggagatgcagcacaccggcggcttcgaggccctgatcggcgccaac
cggggctgcttcgcggcgttcaaggcggtctacgagtgcgccgtgccggtcgtcgccgcg
gtccacggcttctgcctcggcggcggcgtcgggctggtcggcaacgccgactgcgtgatc
gccagcgacgatgcgtacttcggcgtaccggaggtcgaccagggcgcgctcggcgcggcc
acccacctggcccggctggtgccgcagcacctgatgcgcaccctctacttcaccgcgcgg
accatcccggccacggcgctcgtccagttcggctcggtgctcgagaccgtcccccgcgac
cagctcgacgacgccgcgctgaaggtcgccggcgagatcgccgccaaggacacccgggtg
atccgggccgccaaggaggcgctcaacggcatcgacccggtcgacgtgaaccggagctac
cggttcgagcaggggttcaccttcgagctgaacctggccggcgtgagcgacgagctgcga
gacgccttcgcggggaccgacaagggatctcgacgggctcgatccacggaggcacggtga

DBGET integrated database retrieval system