KEGG   Nocardioides sp. JS614: Noca_2816Help
Entry
Noca_2816         CDS       T00443                                 

Definition
FAD-dependent pyridine nucleotide-disulfide oxidoreductase
Orthology
K00384  
thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
nca  Nocardioides sp. JS614
Pathway
Pyrimidine metabolism
Selenocompound metabolism
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:nca00240]
Metabolism; Metabolism of other amino acids; Selenocompound metabolism [PATH:nca00450]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2985794..2986786)
Genome map
AA seq 330 aa AA seqDB search
MPTDNAIDVDLLVIGAGPTGLFATYYAGFRGFRVAVVDSLPELGGQITAMYPEKQILDVA
GFPSVKGRDLVEGLVAQAATADPTYLLDRTATTLHEDDDAENGAVVVGLDDGTEVRAKAV
LITAGIGKFSPRPLPAGDGWLGRGLEFFVPSFAPYAGKDVVIVGGGDSAFDWALHLEPVA
RSVTLVHRRDGFRAHQRTVEAVQASSVQIVTRAEVSAIRGNGVVESIEITVDGESTERPA
QAIVAALGFVADLGPLQQWGLDVEKRHLVVDSSMRTNLARVFAAGDITEYPGKVRLIAVG
FGEAATAVNNAAVVIDPSAHVFPGHSSEGS
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
gtgcctacagacaacgccatcgacgtcgacctcctcgtgatcggggccggtccgaccggt
ctcttcgcgacctactacgccgggttccgcggcttccgggtggcggtggtcgactcactg
cccgagctcggcggccagatcaccgcgatgtaccccgagaagcagatcctcgacgtggcc
gggttcccctcggtcaagggccgtgacctggtcgagggcctggtcgcgcaggccgcgacc
gcggacccgacgtaccttctcgaccggaccgcgaccacgctgcacgaggacgacgacgct
gagaacggtgcggtcgtcgtcggcctcgacgacgggaccgaggtgcgcgccaaggcggtg
ctgatcacggccggcatcggcaagttcagcccccgcccgctgcccgccggcgacgggtgg
ctgggacgcggcctggagttcttcgtgccgagcttcgcgccgtacgccggcaaggacgtg
gtgatcgtcgggggcggcgacagcgccttcgactgggcgctgcacctggagccggtggcc
cgctcggtcacgctggtccaccgccgcgacggcttccgcgcccaccagcgcaccgtcgag
gcggtgcaggcctcgtcggtgcagatcgtgacccgcgcggaggtctccgcgatccgcggc
aacggcgtcgtggagtcgatcgagatcaccgtcgacggggagtcgaccgagcgcccggcc
caggcgatcgtcgcggcgctcgggttcgtcgccgacctcggcccgctgcagcagtggggc
ctcgacgtcgagaagcggcacctggtcgtcgactcctccatgcgcaccaacctggcgcgg
gtcttcgcggccggcgacatcaccgagtaccccggcaaggtgcggctgatcgccgtcggc
ttcggggaggcggcgaccgccgtcaacaacgccgccgtggtgatcgaccccagcgcccac
gtgttccccggccactccagtgaaggaagctag

DBGET integrated database retrieval system