KEGG   Nocardioides sp. JS614: Noca_2889Help
Entry
Noca_2889         CDS       T00443                                 

Definition
protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
nca  Nocardioides sp. JS614
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:nca00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3071650..3073611)
Genome map
AA seq 653 aa AA seqDB search
MPLHYPFSAVLGCDVRADLDDMGLALVLTTISPEIGGVLVRGEKGTAKSTAVRALGALLP
PLVELPIGATEDRVVGSIQLESALSEGKVEVEKGLLARANGGLLYVDEVNLLHDHLVDLL
LDAAAMGRVSVERDGISVEHDARFVLIGTMNPEEGELRPQLLDRFGLTVEVAAPRAPEPR
AEVVRRRMAYDADPVSFIETYAAAEKDLDQRIHGARASLADVVLSDAALLKIAEVCAAFE
VDGLRADIVTARAAVAHAAWEGRDAVTRADIRRAATLALPHRRRRNPFDAPGLDEDLLDR
ILGDDELPPEPPPGTDHEEGPEAAPGTPGTPRTDGAAPSPGADAEGGSDSDGGGTDPSGP
DPALGPPEPQHRPEAADTDDRASTVAAGSPYRPKLLTVRGVGAGASGRRSRARTSTGRRV
GASRPADGRGSLHLLETIRAAAPRQGSRGRTGGRLALRRDDLRVATREGRESNLILFCVD
SSGSMAARKRMIQVKTAILSLLLDAYRRRDKVGLVTFRGDSADLVLPPTHSVDVAAARLD
ELPAGGRTPLAEGLWEAAKVLRRERLRDPRLRPLLVVVTDGRATAGRDAVRRSLQAAEHV
AGLAIASVVIDGEAGPLRLGLAIGLARSLNAEHVPVAEVSAEALTRTVTRKVA
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgccactgcactacccgttttccgccgtcctcggctgcgacgtcagggccgacctggac
gacatgggcctggcactcgtcctcacgacgatctcgcccgagatcggcggcgtgctcgtg
cgcggcgagaagggcaccgccaagtccaccgccgtccgtgcgctcggcgcactgctcccg
ccgctggtcgagctgccgatcggcgccaccgaggaccgggtcgtcggctccatccagctc
gagtccgcgctctcggagggcaaggtcgaggtggagaagggcctgctcgctcgcgccaac
ggcggcctgctgtacgtcgacgaggtcaacctcctgcacgaccacctggtcgatctgctc
ctcgacgccgcggcgatgggccgcgtgagcgtcgagcgcgacgggatctcggtcgagcac
gacgcacggttcgtgctgatcggcacgatgaaccccgaggagggtgagcttcgcccgcag
ctgctcgatcgcttcgggctcaccgtggaggtcgccgcgccgcgcgcgccggagcctcgt
gccgaggtggtccgtcgtcgcatggcgtacgacgccgatccggtcagcttcatcgagacc
tatgctgccgcggagaaggatctcgaccagcgcatccacggtgctcgtgcgtcgttggcc
gacgtggtgctgtccgacgcggccctgctcaagatcgcggaggtctgcgccgcgttcgag
gtggacggcctgcgcgccgacatcgtcaccgcccgcgccgccgtcgctcacgccgcctgg
gagggccgcgacgcggttaccagggccgacatccggcgggccgcgaccctcgcactgccg
caccgtcgccgacgcaacccgttcgacgcgccgggcctcgacgaggacctgctcgaccgc
atcctcggtgatgacgagctgccgcccgagccgcccccggggaccgaccacgaggaaggc
cccgaagctgcgcccgggacgcccgggacgcccaggacggatggggccgcgccttcgccc
ggcgcggacgccgagggcggcagcgacagcgacggcggcgggaccgacccgagcggtccg
gatccggcgctgggcccaccagaaccgcagcaccgccccgaggctgccgacacggacgac
cgtgcgagcacggtcgcagctggctcgccgtaccgaccgaagctgctgaccgtgcgcggc
gtcggtgcgggcgcgagcggccgccgcagtcgggccaggacgagcaccggtcgccgggtc
ggggccagcaggccggccgacggacgcggatcgctccacctgctggagacgatcagggca
gccgcaccccggcaggggtcgcgcggtcgcaccggcgggcggctcgcgctgcgccgcgac
gacctccgggtggcgacgcgcgagggccgcgagtccaacctcatcctgttctgcgtggac
tcctccgggtcgatggcggcgcgcaagcgcatgatccaggtcaagaccgcgatcctgtcg
ttgctcctggacgcctaccgtcggcgcgacaaggtcgggctcgtcacgttccggggtgac
tccgccgacctggtgctgccgccgacccactcggtcgacgttgccgcggcacggctcgac
gagctccctgccggtggccgcacccccctcgccgaagggctgtgggaggccgcgaaggtc
ctgcgccgggaacgactccgcgacccgcgcctgcggccactgctggtcgtcgtcaccgac
ggtcgcgccacggcaggccgcgacgccgtacgccggtcgctgcaggccgccgagcacgtc
gccggcctggcgatcgcctcggtcgtcatcgacggggaggccgggccactgcgactcgga
ctcgcgatcgggctggcgcgaagcctcaacgcggagcacgtccccgtcgccgaggtcagc
gccgaggcgctgaccagaaccgtcaccaggaaggtcgcctga

DBGET integrated database retrieval system