KEGG   Nocardioides sp. JS614: Noca_3025Help
Entry
Noca_3025         CDS       T00443                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nca  Nocardioides sp. JS614
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Noca_3025
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Noca_3025
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Noca_3025
Enzymes [BR:nca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Noca_3025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3225856..3226680)
Genome map
AA seq 274 aa AA seqDB search
MSTRTAFDTARAEGRAALVGYLPAGFPDVAGGIDAMLAMVDAGCDVIEVGLPYSDPVMDG
PTIQAAAQQALERGVRTADVLRTVEAVAATGTPTVVMTYWNPVERYGVSRFAADLANAGG
AGLITPDLTPDSAQEWIAAADEHDLDKVFLVAPSSTEERLAMTTAACRGFVYATAVMGVT
GARATTSDLAGPLVARARSAIAAAGADLPVGVGLGVSTGDQAAELAARNGIGADGVIVGS
AFVRTLLDHPDDPAAGLRALRELTEDLAAGVRRA
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcggaccgcgttcgacacggcgagggccgagggccgggcggcgctcgtgggc
tacctgccggcgggcttcccggacgtcgccgggggcatcgacgccatgctggcgatggtc
gacgccgggtgtgacgtgatcgaggtcgggctgccctacagcgacccggtcatggacggg
cccaccatccaggcggccgcgcagcaggccctcgagcggggcgtccgcaccgccgacgtc
ctgcgcaccgtcgaggcggtcgcggcgaccggcacgccgaccgtcgtgatgacctactgg
aacccggtcgaacggtacggcgtctcgcggttcgccgccgatctcgccaacgccggggga
gcgggtctgatcacgcccgacctcacccccgacagcgcgcaggagtggatcgccgccgcc
gacgagcacgacctggacaaggtgttcctggtcgcgccgtcctcgaccgaggagcggctc
gcgatgacgacggcggcgtgccgcggcttcgtctacgccaccgcggtgatgggcgtgacc
ggcgcccgggcgacgaccagcgacctggccggaccgctcgtggcgcgggccaggagcgcg
atcgcggcggccggcgcggacctgccggtcggcgtgggcctcggcgtcagcaccggcgac
caggccgccgagctggctgccaggaacgggatcggcgccgacggcgtgatcgtgggctcg
gcgttcgtgcgcacgctcctcgaccacccggacgacccggccgcgggcctgcgcgcgctc
cgcgagctgaccgaggacctcgccgccggtgtccggcgtgcgtag

DBGET integrated database retrieval system