KEGG   Nocardioides sp. JS614: Noca_3026Help
Entry
Noca_3026         CDS       T00443                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nca  Nocardioides sp. JS614
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Noca_3026
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Noca_3026
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Noca_3026
Enzymes [BR:nca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Noca_3026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3226677..3227957)
Genome map
AA seq 426 aa AA seqDB search
MTTRPERTTTYDADALGWFGGPAEGFGGRFMPEALVAALDELTVAWQDAMADPEFVAEFD
TILREYAGLPSPLYVAERLSAQVGARILLKREDLAHTGAHKIRNVLGQALLTRRMGKTRV
IAETGAGQHGVASATAAAYFGLDCTVYMGSVDTRRQALNVARMNLLGATVVPVDSGSATL
KDAINEALRDWVATVDHTAYLFGTAAGPHPFPSMVRDFTRGIGDEARAQCLERFGRLPDA
IAACVGGGSNAIGLFSAFLDDADVAIYGFEAGGEGFETGRHAATIHAGDRGVLHGARTYV
LQDEDGQTLESHSISAGLDYPGVGPQHAHLAATGRATYLPVTDDEAMAALALLSRTEGII
PAIESAHAVAGGLRVAERLAAEQGPDATVLINLSGRGDKDMGTAIEYFGLVDGQHAGGHG
AGEPIG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccaggcccgagcggacgacgacgtacgacgcggacgcgctcggctggttcggc
ggccccgcggagggcttcggcgggcggttcatgcccgaggccctggtggcggccctcgac
gagctcaccgtcgcctggcaggacgcgatggccgatccggagttcgtcgcggagttcgac
acgatcctgcgcgagtacgccggcctcccgagcccgctctacgtcgccgagcggctcagc
gcccaggtcggtgcccggatcctgctcaagcgcgaggacctcgcccacaccggcgcgcac
aagatccgcaacgtgctgggccaggcgctgctgacccggcggatgggcaagacccgggtg
atcgcggagaccggcgccgggcagcacggcgtggccagcgcgacggccgcggcctacttc
ggtctcgactgcacggtctacatgggctcggtcgacacccggcggcaggcgctcaacgtc
gcccggatgaacctgctcggcgccaccgtcgtccccgtcgactccggcagcgccacgctc
aaggacgcgatcaacgaggcgctgcgcgactgggtcgccaccgtcgaccacacggcatac
ctcttcggcaccgcggccgggccgcacccgttccccagcatggtccgcgacttcacccgc
ggcatcggcgacgaggcccgggcgcagtgcctcgagcgcttcggccggctcccggacgcg
atcgcggcctgcgtcggcgggggctccaacgcgatcggcctgttctcggccttcctcgac
gacgcggacgtcgcgatctacgggttcgaggccggtggcgagggcttcgagaccggccgg
cacgccgccacgatccacgcgggggaccgcggcgtcctgcacggggcgcgcacctacgtc
ctccaggacgaggacggccagaccctcgagtcgcactcgatctcggccgggctggactac
cccggcgtcggcccgcagcacgcgcacctggccgcgaccgggcgcgcgacgtacctcccg
gtgaccgacgacgaggccatggcggcactcgccctcctcagccgcaccgagggcatcatc
ccggcgatcgagtccgctcacgctgtcgccggcgggctccgggtcgccgagcggctggcc
gcggagcaggggccggacgcgacggtgctgatcaacctgagcgggcgcggcgacaaggac
atgggcaccgcgatcgagtacttcggcctggtcgacggccagcacgccggaggccacgga
gccggggagccgatcggatga

DBGET integrated database retrieval system