KEGG   Nocardioides sp. JS614: Noca_3045Help
Entry
Noca_3045         CDS       T00443                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00340  Histidine metabolism
nca01100  Metabolic pathways
nca01110  Biosynthesis of secondary metabolites
nca01230  Biosynthesis of amino acids
Module
nca_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Noca_3045
Enzymes [BR:nca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Noca_3045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ABL82547
JGI: Noc3045
UniProt: A1SL62
Position
complement(3241998..3243296)
Genome map
AA seq 432 aa AA seqDB search
MIRRIDLRGADPGVDYRAAVPRADFDIEAAVPAVHAICEDVRTRGLDAIRELSERFDGVA
VDDIRVAPEALATALERLDPDIRAALEESIARLRATCANELEQDAVTDLGPGARVTHRKV
PVGRVGLYVPGGLAPLVSSVLMNVVPAQTAGVGSIALASPPQREFAGAVHPTILAACALL
GVEEVYAVGGAQAIAMFAYGTGPCRRVDLVTGPGNIYTVTAKRLLKGLVGIDSEAGPTEI
AILADDTADPAYVAADLLSQAEHDPLAAAVLVTPSDRLADAVAAELETQVAATKHVERIR
TSLSGRQSGVVLVDDLEQGLEVVNAYAAEHLEIHTEDAAAYAARVRNAGAIFVGPYAPVS
LGDYCAGSNHVLPTAGCACHSSGLSVRAFTKSVHVVDYSRAALDAVAGHVVTLAEAEDLP
GHGAAVRVRFGG
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgatccgccgcatcgacctgcgaggcgccgacccgggtgtcgactaccgggcagccgtg
ccccgtgccgacttcgacatcgaggccgcggtcccggcggtgcatgcgatctgcgaggac
gtccggacccgcgggctggacgcgatccgcgagctctcggagcgcttcgacggcgtcgcc
gtggacgacatccgggtcgccccggaggcgctggccaccgcgctcgagcggctcgacccc
gacatccgggccgccctggaggagtcgatcgcgcggctgcgggccacctgcgcgaacgag
ctcgagcaggacgccgtcaccgacctcggccccggcgcccgggtcacccaccgcaaggtg
ccggtcggccgggtcggcctctacgtccccggcgggctggccccgctggtctccagcgtg
ctgatgaacgtcgtgccggcccagaccgccggcgtcgggtcgatcgcgctcgcgagcccg
ccccagcgtgagttcgcaggcgcggtgcacccgacgatcctggcggcgtgcgcgctgctg
ggggtcgaggaggtgtacgccgtcggcggcgcccaggcgatcgcgatgttcgcctacggc
accgggccgtgccggcgggtcgacctggtgaccgggcccggcaacatctacacggtcacc
gccaagcggctgctcaagggcctggtcggtatcgactcggaggcgggccccaccgagatc
gcgatcctcgccgacgacacggcggacccggcgtacgtcgccgccgacctgctcagccag
gccgagcacgacccgctcgccgccgccgtgctcgtcacgccctccgaccggctggccgac
gcggtcgcggccgagctcgagacgcaggtcgcggccaccaagcacgtcgaacggatccgc
accagcctctccgggcggcagtccggggtcgtcctcgtcgacgacctcgagcagggcctc
gaggtcgtgaacgcctacgccgccgagcacctcgagatccacaccgaggacgccgcggcg
tacgccgcccgggtccgcaacgccggcgcgatcttcgtcggcccctacgccccggtcagc
ctcggcgactactgcgccggctccaaccacgtgctgccgaccgccggctgcgcctgccac
tcctcgggcctctcggtgcgcgcgttcaccaagtcggtccacgtggtcgactactcccgc
gcggcgctcgacgccgtggccgggcacgtcgtcacgctggccgaggccgaggacctcccc
ggccacggcgcggccgtccgggtgcggttcgggggctga

DBGET integrated database retrieval system