KEGG   Nocardioides sp. JS614: Noca_3068Help
Entry
Noca_3068         CDS       T00443                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
nca  Nocardioides sp. JS614
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Noca_3068
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Noca_3068
Enzymes [BR:nca01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Noca_3068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3266753..3268267)
Genome map
AA seq 504 aa AA seqDB search
MVSDSNRPAQPPRTPLATVAAWAGAELRGNPAGLEVSGISLSSQRIRPGDLYAALPGSRA
HGIEFAQDALAAGAVAVFTDEAGADRGPAGAPHLVVDRPRAVLGRLSARIYGEPAASMRM
VGVTGTQGKTTTTRLLEAGLQQAGVPAAVVGTVGTRIAGEEVRSSLTTPEAPDLHALFAV
MRERDVRACAMEVSSHALVMGRVDGVVFDVAVFLNLGRDHLDFHRDLEDYYAAKASLFTP
ERARFALVNVDDAHGRRLAEEATVPVRTFSMGRGDDAQRADWRAVDVRLRATGSEFVVVA
PDGRRIPAGCALPGDFNVANTLAAVAAAAEAGLDPAVVAAGIAAAGGVPGRLERVDAGQD
FLVVVDYAHKPDAVEAAIRTLRPLTEGRVIVVLGAGGDRDPGKRPIMAGIAARLADLLVV
TDDNPRTEDPAAIRAAMLAGVVTGQAIEVGGRRAAIREALRRAGPGDIVLIAGKGHETGQ
EVDGVVHPFDDREVVREEIVACSR
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
gtggtgagcgactccaaccggcccgcgcagccgccccggacgccgctcgcgaccgtggcg
gcctgggccggtgccgagctgcgcggcaaccccgcgggcctggaggtcagcggcatctcg
ttgtcctcgcaacggatccggcccggtgacctctacgcggcgcttcccggcagccgcgcc
cacggcatcgagttcgcccaggacgcgctcgcggccggcgcggtcgcggtcttcaccgac
gaggcgggagccgaccggggccccgcgggggctccgcacctggtcgtcgaccggccccgc
gccgtgctcggccggctctcggcgcgcatctacggcgagcccgcggcgtcgatgcggatg
gtcggggtcaccggcacccagggcaagaccaccacgacccggctgctcgaggccggcctc
cagcaggccggggtgccggccgccgtggtcggcacggtcggcacccggatcgccggcgag
gaggtgcggtcgtcgctgaccacgcccgaggcgcccgacctccatgccctgttcgcggtg
atgcgcgagcgcgacgtgcgcgcctgcgcgatggaggtctccagccacgcactggtgatg
ggccgggtggacggggtcgtgttcgacgtcgcggtgttcttgaacctgggccgcgaccac
ctcgacttccaccgcgacctcgaggactactacgcggccaaggcctcgctgttcaccccc
gagcgcgcccggttcgccctcgtgaacgtcgacgacgcgcacggccgccggctggccgag
gaggccaccgtgccggtccggacgttctcgatgggccggggagacgacgcacagcgggcc
gactggcgggctgtcgacgtgcggctgcgggccaccggctcggagttcgtcgtcgtcgcc
cccgacggccgccggatcccggccgggtgcgcgctgcccggcgacttcaacgtcgccaac
acgctcgcggccgtggcggccgcggccgaggccggcctggaccccgcggtggtcgccgcg
gggatcgccgcggccgggggcgtgcccgggcgtctcgagcgcgtcgacgccggtcaggac
ttcctggtcgtcgtcgactacgcccacaagcccgatgcggtcgaggcggccatccggacg
ctgcgcccgctcaccgaggggcgggtgatcgtcgtcctcggcgccggcggcgaccgcgac
ccgggaaagcgcccgatcatggctgggatcgccgctcggctggccgatctgttggtggtg
accgacgacaacccgcgcacggaggacccggccgcgatccgggcggccatgctcgccggg
gtcgtgaccggtcaggcgatcgaggtcggcggccgacgggccgcgatccgcgaggcgctg
cgccgggccggaccgggagacatcgtgctgatcgccggcaagggacacgagacggggcag
gaggtcgacggagtggtccatcccttcgacgaccgcgaggtcgtgcgggaggagatcgtc
gcgtgctcgagatga

DBGET integrated database retrieval system