KEGG   Nocardioides sp. JS614: Noca_3101Help
Entry
Noca_3101         CDS       T00443                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
nca  Nocardioides sp. JS614
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:nca00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3304470..3305951
Genome map
AA seq 493 aa AA seqDB search
MSVLAIDAGTTGVTAVVVEHDGSIAVKGYQEFAQHFPQPGWVEHSPEEIWQATLEAVRDV
LQRYDASRLEAVGITNQRETVLLWDRETLGSPRRAIVWQDRRTADLCTRLREAGHEARVS
ELTGLRLDPYFSGTKLMWLAENEPHTWALVESGRYAIGTVDSYLIARMTRGTWHATDVSN
ASRTLLLDLETGEWSDELCSLFGVPRDALPELVPNWGEIATTDPTTFLDLSLPISGLAGD
QQSALFGQTCFDEGDSKCTYGTGSFILTNTGTTIQRSDAGLLATAAWRSPSGELTYATEG
AIFVTGAAVQWLRDGLQIVGSAAETEPIARTVADTGGVVFVPALTGLGAPHWDPHARGLV
IGITRGTTRAHLVRAALEAIAFEVRDVLDTLSGAGAGLSSLRVDGGASANNLLCQIQADQ
VGVPVERPATVETTALGAAFLAGLGAGVWGSTDDLRETWRLDRRFEPALDRPTADAAHAR
WTDAVERAKDWAD
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcctcgcgatcgacgccggcaccaccggggtcaccgccgtggtggtggagcac
gacggctcgatcgcggtcaagggctaccaggagttcgcgcagcacttcccccagcccggc
tgggtggagcattcccccgaggagatctggcaggccaccctggaggcggtccgggacgtg
ctccagcggtacgacgcgtcgcggctcgaggccgtcgggatcaccaaccagcgcgagacg
gtgctgctctgggaccgcgagaccctcgggtcgccgcgccgcgcgatcgtctggcaggac
cgtcgtaccgccgacctgtgcacgcggctgcgcgaggccggccacgaggcgcgggtcagc
gagctgaccgggctgcgcctggacccgtacttctcgggcaccaagctgatgtggctggcc
gagaacgagccgcacacctgggcgctggtcgagtcgggccgctacgcgatcggcaccgtc
gactcctacctgatcgcgcggatgacccgtggcacctggcacgccaccgacgtgtcgaac
gcgtcccggacgctcctgctcgacctggagaccggcgagtggtccgacgagctgtgctcg
ctgttcggggtgccgcgcgacgcgctgccggagctggtgccgaactggggcgagatcgcg
accaccgacccgacgacgttcctcgacctgtcgctgccgatctcgggcctggccggcgac
cagcagtccgcgctgttcggccagacctgcttcgacgagggcgactccaagtgcacctac
gggaccgggtcgttcatcctcaccaacaccggcacgacgatccagcgctcggacgccgga
ctcctcgcgacggccgcctggcgctcgccgtccggcgagctcacctacgcgaccgagggc
gcgatcttcgtgaccggtgccgccgtgcagtggctgcgcgacgggctgcagatcgtgggc
tcggccgccgagaccgagccgatcgcgcgcaccgtcgccgacaccggcggggtcgtcttc
gtgcccgcgctgaccggcctgggcgcgccgcactgggacccgcacgcccggggcctggtc
atcggcatcacccgcggcaccacccgcgcacacctggtccgcgccgcgctcgaggcgatc
gcgttcgaggtccgcgacgtgctcgacaccctctccggcgcgggcgccgggctgtcctcg
ctgcgcgtggacggcggcgcctccgccaacaacctgctctgccagatccaggccgaccag
gtcggcgtaccggtcgagcgcccggcgaccgtcgagaccaccgccttgggcgccgcgttc
ctggccgggctcggggccggcgtgtgggggtcgaccgacgacctccgcgagacctggcgg
ctggatcggcgcttcgagcccgccctcgaccggcccaccgccgacgccgcccacgcccgc
tggaccgacgccgtcgagcgcgccaaggactgggccgactga

DBGET integrated database retrieval system