KEGG   Nocardioides sp. JS614: Noca_3105Help
Entry
Noca_3105         CDS       T00443                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
nca  Nocardioides sp. JS614
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3308278..3309051
Genome map
AA seq 257 aa AA seqDB search
MTIHPLATPLSRPARPELTGGRRVGVLLSHGFTGQPASITPWGEALAEHGYAVEVPRLPG
HGTTWQELNTLTWADWYAEITRTFEKLLADNDAVVVGGLSMGGALVLRLAADRPDRVAGV
VVVNPALATKRLDVKLLPLLKHVVPSFPGIANDIKKSGVQEHGYDRTPLKAIHSMMRAWP
GLVRDLPRITAPVLYFRSTEDHVVDEATEPLILSGISSRDVTVTRLPESYHVATLDNDAE
QIYADTAAFVARVTSGS
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccacccgctcgccaccccgctctcccgcccggcgcggccggagctcaccggc
ggccgacgcgtcggcgtgctgctcagccacggcttcaccggccagccggcctccatcacg
ccgtggggcgaggccctggcggagcacgggtacgccgtcgaggtgccgcgcctgcccggg
cacggcacgacctggcaggagctgaacaccctgacctgggcggactggtacgccgagatc
acccgcacgttcgagaagctcctcgcggacaacgacgcggtcgtggtgggcgggctgtcg
atgggcggtgccctggtgctgcggctggcggcggaccgccccgaccgggtcgcgggcgtc
gtcgtggtgaaccccgcgctcgccacgaagcggctggacgtgaagctgctgccgctgctc
aagcacgtcgtgccgtccttcccgggcatcgccaacgacatcaagaagtccggcgtgcag
gagcacggctacgaccggaccccgctcaaggcgatccactcgatgatgcgggcctggccc
ggcctggtccgcgacctgccccggatcaccgcacccgtgctctacttccgctcgaccgag
gaccacgtcgtcgacgaggcgaccgagccgctgatcctgtccgggatctcctcgcgcgac
gtcacggtcacccggctgccggagagctaccacgtcgcgaccctcgacaacgacgccgag
cagatctacgcggacaccgccgcattcgtggcccgcgtcacctccggttcgtag

DBGET integrated database retrieval system