KEGG   Nocardioides sp. JS614: Noca_3108Help
Entry
Noca_3108         CDS       T00443                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00010  Glycolysis / Gluconeogenesis
nca00052  Galactose metabolism
nca00500  Starch and sucrose metabolism
nca00520  Amino sugar and nucleotide sugar metabolism
nca00521  Streptomycin biosynthesis
nca01100  Metabolic pathways
nca01110  Biosynthesis of secondary metabolites
nca01120  Microbial metabolism in diverse environments
nca01130  Biosynthesis of antibiotics
nca01200  Carbon metabolism
Module
nca_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Noca_3108
   00052 Galactose metabolism
    Noca_3108
   00500 Starch and sucrose metabolism
    Noca_3108
   00520 Amino sugar and nucleotide sugar metabolism
    Noca_3108
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Noca_3108
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Noca_3108
Enzymes [BR:nca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Noca_3108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ABL82610
JGI: Noc3108
UniProt: A1SLC5
Position
complement(3310827..3311834)
Genome map
AA seq 335 aa AA seqDB search
MPLFIGVDIGGTKVLATAVSRSGRVLRTARRTTPGRRVEARLVEDALTEAVQEIAGLRRI
GAIGIAAAGFVDAQGERVRFAPHLPWRDEGVRARLAERWSAPVVLDNDANCAARAELTYG
AVGNAADAIVVTMGTGIGGAVVLGGAVHRGHNGMAGEFGHMQVVPGGQACECGGTGCWEQ
YASGNALVRHARARIGSRPTALEAACAGEPDRLTGPMVTAAAEAGDAVALEAFADVGGWL
GVGVANLVAAFDPEIVVVGGGLSAAGDLLLEPARVAMRESLVGAAHRTVPPVVRAALGPE
AGAIGAAELARQTFRSAGTRARARRRAARGTARRR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtgccactcttcatcggggtcgacatcggcgggacgaaggtgctggccacggcggtctcg
cgctcgggccgggtgctgcgcaccgcccgtcgtacgacgccgggccggcgggtggaggcc
cggctggtcgaggacgcgctgaccgaggcggtccaggagatcgccggcctccgccggatc
ggcgcgatcgggatcgcggccgccggcttcgtcgacgcccagggggagcgggtccggttc
gcgccgcacctgccgtggcgtgacgagggcgtccgggcccggctcgcggagcgctggagc
gcaccggtcgtgctcgacaacgacgccaactgcgcggcccgcgccgagctgacctacggc
gccgtggggaacgccgccgacgcgatcgtggtgacgatgggcaccggcatcggtggcgcg
gtggtgctcggcggcgcggtccaccggggccacaacgggatggccggagagttcgggcac
atgcaggtggtccccggcggtcaggcgtgcgagtgcgggggcaccggctgctgggagcag
tacgccagcggcaacgcgctggtgcggcacgcgcgggcccggatcggcagccggccgacc
gcgctcgaggccgcctgcgccggcgagcccgaccggctcaccgggccgatggtcaccgcg
gcggccgaggccggggacgcggtcgcgctcgaggccttcgccgacgtcggcgggtggctg
ggggtcggggtcgcgaacctggtcgcggcgttcgaccccgagatcgtggtcgtgggcggc
ggcctgtccgcggccggcgacctgctgctcgagccggcccgggtcgcgatgcgtgagtcg
ctggtgggcgccgcccaccgcaccgtgccgccggtggtccgcgccgccctcggccccgag
gcgggtgcgatcggggccgccgagctggcccggcagacgttcaggagcgccggtactcgg
gcacgagctcgacggcgagctgctcgaggaacagcccgacgtcggtga

DBGET integrated database retrieval system