KEGG   Nocardioides sp. JS614: Noca_3322Help
Entry
Noca_3322         CDS       T00443                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nca  Nocardioides sp. JS614
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Noca_3322
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Noca_3322
  Lipid metabolism
   00071 Fatty acid degradation
    Noca_3322
  Amino acid metabolism
   00350 Tyrosine metabolism
    Noca_3322
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Noca_3322
   00626 Naphthalene degradation
    Noca_3322
Enzymes [BR:nca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Noca_3322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3530390..3531406)
Genome map
AA seq 338 aa AA seqDB search
MHANQLTTPAHLSHHPLLWTDVDRPEPSRGQLLVKVAGCGVCRSNLHMIEGDWVEGGVPA
ISPIIPGHEVTGRVAAIGAGVEGFEVGDPVGVQPLWWTCGECEFCTTGREQLCHERIITG
EHVDGGYAEYMLSFAEHTYRIPESLDLIDAAPLFCPGITAYGALDKIDVGPGDVVAVFGL
GGVGHMAVQMAVLTGAEVVAVGRTPAHLEVAKELGAARTVDSTDQDALDLIADTADAVLT
FAGSDEVTAQAMRTLKWGGTLVNGVPINVEEFHFNKGQTIKGSILGNREQMRAVLQLAAE
GKIRTVVERFPMAQAEDALTRLANGELRSRGVLYNSTE
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcgaaccagctcacgacccccgcccacctctcgcaccatccactcctctggacc
gatgtcgaccgtcccgaaccgagccgaggccagctgctggtcaaggtggcaggctgcgga
gtctgccggtcgaacctccacatgatcgagggggactgggtcgagggcggggttccggca
atcagcccgatcatcccggggcacgaggtcaccggccgggtcgccgcgatcggtgcaggc
gtcgagggattcgaggtcggtgaccccgtgggtgtgcagccgctatggtggacctgcggc
gaatgcgagttctgcacgaccggccgggagcagttgtgccacgagcggatcatcaccggg
gaacacgtcgacggcggatacgcggagtacatgctctcgtttgccgagcacacctaccgg
atcccggagtcgctcgacctgatcgatgccgcgccgttgttctgccccgggatcactgcc
tatggggccctcgacaagatcgatgtagggccgggagatgtcgtggccgtcttcggtctc
gggggcgtcggtcacatggccgtccagatggcggtgttgaccggggccgaggtcgtggcg
gtgggccggacgccggcccacctggaggtcgcgaaagagctcggcgccgcgcgcacggtc
gactccaccgatcaggatgctctcgacctcatcgcggacaccgccgacgccgtcttgacc
ttcgccggatccgacgaggtcactgcacaggcgatgcgaaccctcaagtggggcggcacc
ctcgtgaacggggtgccgatcaacgtcgaggagttccacttcaacaagggtcagacgatc
aagggctcgatcttgggcaaccgcgaacagatgcgagctgtcctgcagctcgccgcggaa
ggcaagatccgcacggtcgtcgagcgcttcccgatggctcaggccgaggatgcgttgact
cggctggccaacggcgagctgcgttcgcgaggcgtgctgtacaactcgacggagtag

DBGET integrated database retrieval system