KEGG   Nocardioides sp. JS614: Noca_3354Help
Entry
Noca_3354         CDS       T00443                                 

Definition
GTP cyclohydrolase (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
nca  Nocardioides sp. JS614
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:nca00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3554875..3555534
Genome map
AA seq 219 aa AA seqDB search
MSQLVTQPLNQPLSHAASEARARWRPRVSQPAAEVDLVAAESAASDLLRALGLDIETDEM
VETPRRLVAAYHELLTGPDVDLTTFPNTEGYDELVLVANIPVRSVCEHHMLPFVGVAHVG
YLPDERILGLSKFARLVELVARRPQTQERLTTEVADHLTTHLQPRGVGVVIEAEHTCMSL
RGVRAQGTRTVTSALRGTLRDHAARAEFLSLAREQGARP
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
gtgagccagctggtgacccagccgttgaaccagccgttgagccacgccgccagcgaggcc
cgggcccgctggcggccgcgggtctcgcagcccgcggccgaggtcgacctggtcgcggcc
gagagtgccgccagcgacctgctgcgcgccctcggcctggacatcgagaccgacgagatg
gtcgagaccccgcgccggctggtggcggcgtaccacgagctgctcaccggccccgacgtc
gacctgacgaccttccccaacaccgagggctacgatgaattggtgctggtggccaacatc
cccgtgcgctcggtgtgcgaacaccacatgctgcccttcgtgggtgtcgcccacgtcggc
tacctgcccgacgagcggatcctgggactctcgaagttcgctcgactcgtcgagctcgtc
gcccgccgtccgcagacccaggagcggctgaccaccgaggtcgccgatcacctgaccacg
cacctccagccgcgtggcgtcggcgtcgtcatcgaggccgagcacacctgcatgagcctg
cgcggcgtgcgcgcccagggcacccgcacggtcacctccgcgctgcgcgggaccctgcgg
gaccacgccgcccgcgccgagttcctgtcgctggcccgcgagcagggggcccggccgtga

DBGET integrated database retrieval system