KEGG   Nocardioides sp. JS614: Noca_3382Help
Entry
Noca_3382         CDS       T00443                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
nca  Nocardioides sp. JS614
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Noca_3382
Enzymes [BR:nca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Noca_3382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3584182..3585147
Genome map
AA seq 321 aa AA seqDB search
MHEPRVNDGGTVGPVDGLQVPRFAGHSTFARLPRLEDVETFDVAVVGVPFDSGVTYRPGA
RFGPSHIRQGSRLLRPYNPALDVSPFAGVQVVDAGDIAANPFSIEDGLEQIEAGVRELSA
DGRNVVLLGGDHTVTLPALRALKAQHGPIALVHFDAHLDTWDTYFDAPFTHGTPFRRAWQ
EGLLDADHTMHVGIRGSLYSKDDLADDASMGFSIVPARDLDRLGADRVVEMVRERVGDAP
VYISIDIDVLDPGFAPGTGTPEAGGLTSRELLAMVRGFAGAHVVGADVVEVSPPYDHAEI
TAIAAANLAYEYCSVFAWNRR
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcacgagcctcgggtcaacgacggcggcaccgtcgggccggtcgacggtctgcaggtc
ccccggttcgcggggcacagcacgttcgccaggctgccacgcctggaggacgtggagacc
ttcgacgtggccgtggtcggcgtgcccttcgactccggtgtcacctaccgtcccggcgca
cgcttcggcccgtcccacatccgccagggatcacgcctgctgcggccgtacaaccccgcg
ctcgacgtctccccgttcgccggggtccaggtggtcgacgccggcgacatcgccgccaac
ccgttctccatcgaggacgggctcgagcagatcgaggcgggggtgcgagagctgtcggcc
gacgggcgcaacgtcgtcctcctgggtggtgaccacacggtcacgctcccggcgctgcgt
gccctcaaggcacagcacgggccgatcgcgctggtgcacttcgacgcccacctcgacacg
tgggacacctacttcgacgcaccgttcacgcacgggacgccgttccggcgtgcctggcag
gagggcctgctcgacgccgaccacaccatgcacgtggggatccgcgggtcgctgtactcc
aaggacgacctcgccgatgatgcctccatgggcttctcgatcgtgcccgcacgcgacctg
gaccgcctcggcgcggaccgggtggtggagatggtccgcgaacgggtcggggacgcgccg
gtctacatctcgatcgacatcgacgtgctcgaccccggcttcgcgccgggcaccggcact
cccgaagccggtggcctgaccagccgcgagctgctcgcgatggtgcgcgggttcgccggc
gcgcacgtcgtcggcgccgacgtcgtcgaggtgtccccgccctacgaccacgcggagatc
accgccatcgctgcggcgaacctggcctacgagtactgctcggtcttcgcctggaaccgc
cggtga

DBGET integrated database retrieval system